SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000034831 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000034831
Domain Number 1 Region: 107-121,163-395
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.36e-65
Family Nuclear receptor ligand-binding domain 0.0000233
Further Details:      
 
Domain Number 2 Region: 38-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.76e-29
Family Nuclear receptor 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000034831   Gene: ENSMUSG00000032292   Transcript: ENSMUST00000034831
Sequence length 395
Comment pep:known chromosome:GRCm38:9:59942771:59950117:-1 gene:ENSMUSG00000032292 transcript:ENSMUST00000034831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTVAASTMPVSVAASKKESPGRWGLGEDPTGVGPSLQCRVCGDSSSGKHYGIYACNGC
SGFFKRSVRRRLIYRCQVGAGMCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSM
AQVHLDAMETGSDPRSEPVVASPALAGPSPRGPTSVSATRAMGHHFMASLITAETCAKLE
PEDAEENIDVTSNDPEFPASPCSLDGIHETSARLLFMAVKWAKNLPVFSNLPFRDQVILL
EEAWNELFLLGAIQWSLPLDSCPLLAPPEASGSSQGRLALASAETRFLQETISRFRALAV
DPTEFACLKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLL
PSLRFLTAERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences Q543C7 Q9QXZ7
10090.ENSMUSP00000034831 ENSMUSP00000034831 ENSMUSP00000034831 NP_038736.1.92730 ENSMUSP00000034831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]