SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000035579 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000035579
Domain Number 1 Region: 20-125
Classification Level Classification E-value
Superfamily SRCR-like 1.05e-40
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00000488
Further Details:      
 
Domain Number 2 Region: 131-246
Classification Level Classification E-value
Superfamily POZ domain 0.000000314
Family BTB/POZ domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000035579   Gene: ENSMUSG00000033880   Transcript: ENSMUST00000043722
Sequence length 577
Comment pep:known chromosome:GRCm38:11:118392751:118402092:-1 gene:ENSMUSG00000033880 transcript:ENSMUST00000043722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALLWLLSVFLLVPGTQGTEDGDMRLVNGASANEGRVEIFYRGRWGTVCDNLWNLLDAHV
VCRALGYENATQALGRAAFGPGKGPIMLDEVECTGTESSLASCRSLGWMVSRCGHEKDAG
VVCSNDTTGLHILDLSGELSDALGQIFDSQQGCDLFIQVTGQGYEDLSLCAHTLILRTNP
EAQALWQVVGSSVIMRVDAECMPVVRDFLRYFYSRRIEVSMSSVKCLHKLASAYGATELQ
DYCGRLFATLLPQDPTFHTPLDLYAYARATGDSMLEDLCVQFLAWNFEPLTQSESWSAVP
TTLIQALLPKSELAVSSELDLLKAVDQWSTETIASHEDIERLVEQVRFPMMLPQELFELQ
FNLSLYQDHQALFQRKTMQALEFHTVPVEVLAKYKGLNLTEDTYKPRLYTSSTWSSLVMA
STWRAQRYEYNRYNQLYTYGYGSVARYNSYQSFQTPQHPSFLFKDKQISWSATYLPTMQS
CWNYGFSCTSNELPVLGLTTSSYSNPTIGYENRVLILCGGYSVVDVTSFEGSKAPIPTAL
DTNSSKTPSLFPCASGAFSSFRVVIRPFYLTNSTDMV
Download sequence
Identical sequences Q07797
NP_035280.1.92730 ENSMUSP00000035579 ENSMUSP00000035579 10090.ENSMUSP00000035579 ENSMUSP00000035579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]