SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000036240 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000036240
Domain Number 1 Region: 131-454
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 6e-66
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000224
Further Details:      
 
Domain Number 2 Region: 446-454,483-606
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.38e-29
Family Ricin B-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000036240   Gene: ENSMUSG00000038072   Transcript: ENSMUST00000045737
Sequence length 608
Comment pep:known chromosome:GRCm38:5:25222882:25265918:1 gene:ENSMUSG00000038072 transcript:ENSMUST00000045737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSITVRYFCYGCLFTSATWTVLLFIYFNFSEVTQPLRNVPIKGSGPHGPFPKKFYPRFT
RGPGRVLDPQFKANRIDRLMNNHIEDPDKGLSKSSSELGMIFNERDQELRDLGYQKHAFN
MLISNRLGYHRDVPDTRNAECRRKSYPTDLPTASIVICFYNEAFSALLRTVHSVVDRTPA
HLLHEIILVDDSSDFDDLKGELDEYIQRYLPAKVKVIRNMKREGLIRGRMIGAAHATGEV
LVFLDSHCEVNVMWLQPLLAIILEDPHTVVCPVIDIISADTLAYSSSPVVRGGFNWGLHF
KWDLVPVSELGGPDGATAPIRSPTMAGGLFAMNRQYFNDLGQYDSGMDIWGGENLEISFR
IWMCGGKLFILPCSRVGHIFRKRRPYGSPEGQDTMTHNSLRLAHVWLDEYKEQYFSLRPD
LKNKSFGNISERVELRKKLGCQSFKWYLDNIYPEMQIPGPNAKPQQPVLINRGPKRPRVL
QRGRLYHLQTNKCLVAQGRSSQKGGLVLLKTCDYGDPTQVWIYNEDHELILNNLLCLDMS
ETRSSDPPRLMKCHGSGGSQQWTFGKNNRLYQVSVGQCLRVMDLMDQKGYVGMAICDGSS
SQQWRLEG
Download sequence
Identical sequences Q921L8
10090.ENSMUSP00000110602 ENSMUSP00000036240 ENSMUSP00000110600 ENSMUSP00000110602 ENSMUSP00000036240 NP_659157.1.92730 XP_006535744.1.92730 XP_011248066.1.92730 ENSMUSP00000036240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]