SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038379 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038379
Domain Number 1 Region: 1445-1513
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000197
Family SH3-domain 0.0025
Further Details:      
 
Domain Number 2 Region: 999-1173
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000012
Family RUN domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038379   Gene: ENSMUSG00000035969   Transcript: ENSMUST00000035645
Sequence length 1523
Comment pep:known chromosome:GRCm38:4:43381979:43427088:1 gene:ENSMUSG00000035969 transcript:ENSMUST00000035645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLELSRMDSPPKLTGETLIVHHIPLVHCQVPDRQCCGGAGGGGGGTRANPFCPPELGL
TQPDHDLGQADSLLYPSLHSAPGAPTGSSDSVKSRSRDGRGPGAPKRHNPFLVQEGVGET
GLGDLHDSSTGDSVTQQSFHLHSASQPFHLSSFQLPPSGPGQGRPWGATHSRPGVVEGQE
QDPATALGTQCSTSHCCRPELEAERMELDECGGHGGSGSGGGTSDISGFSFEQEWKISSD
ESPRHPGRSGSGTQHCHCSSTSSQSEAADQSMGYVSDSSCNSSDGVLVTFSTLYNKMHSS
SRANLNSVPQSCSDSSFCSHADPGAFYLDLQPSPAESRMSCESHHPENGDREEGCGCPHV
SSPELDANCNAYHPHSEPCPAVADLTACFQSQARLVVATQNYYKLVTCDLSSQSSPSPAG
SSITSCSEEHTKISPPPGPCPDPDPNQPSEYYLFQKPDIQPEEQEAVGSPAEAATAMGPT
VLEGQVYTNTSPPNLNTGRQRSRSYDRSLERSPPVRLGSLERMLSCPVRLSEGPAALAGP
ASPPRRVTSFAELAKGRKKAAGSGSPPLRASVGDSSQEFSPIQEAQQDRAAPLDEGTRCS
HSLPSLPLGPSLDLLGPEPWSTPVCQGSQSSEMPLPSLRAAGQGPLAQLMDPGPAFSGSP
ATSHTQRDSRARADGGGTESRPVLRYSKEQRPTTLPIQPFVFQHHFPKQLAKARALHSLS
QLYSLSMPCSRAQQPAPLVISTAQGPAPAPSGEPQPFTSQASGRGARNAGPEPETSRPSP
LGSYSPVRSAGPFGSSTDSSASTSCSPPPEQGTAADSVSPWSHTCPPTVRPATSQQPPKE
DQKIPTLAEYRLHGTGSLPPLGSWRSGFTRAESLVRGGGEGSMANRPNNANHLSPQALKW
REYRRKNPLGPPGLSGSLDRRPPEARLARRNPIFEFPGSFGTTSHLNCRLNGQISKPLSL
TCPDLQDPFSLTEKPPAEFCLSPDGNSEAISIDILQKKGLVKAVNTAVDLIVAHFGTSRD
PGVKAKLGNSSVSPNVGHLVLKYLCPAVQAVLEDGLKAFVLDVIIGQRKNMPWSVVEAST
QLGPSTKVLHGLYNKVSQFPELTSHTMRFNAFILGLLNIRSLEFWFNHLYNHEDIIQTHY
QPWGFLRAAHTVCPGLFEELLLLLQPLALLPFSLDLLFQHRLLQSGRQQRQHKELLRVSQ
DLLLSAHSTLQLARSRGQEGPGDMDRVAPGERVKGVGASEGGEEDEEDAEEVAVVAGSSD
HGKWARGGQAGWWYQLMQSSQVYIDGTAEGSRFPRSSSSSSGSGSEKKKGVGSGGPSQAP
PPPPREGVVEGAEACPAPEEALGQERGWPFWMGSPPDSVLAELRRSREREGPVAPPTENE
EGTAEPSPGGIKWGHLFGSRKSQREARPTNRLPSDWLSLDKSVFQLVAQTMGARREPEPR
ENLQESHPPAVPSKPPCEVQALCHHLATGPGQLSFHKGDILRVLGPARGDWLRCSRGPDT
GLVPLAYVTLTPTPSSPPGSSQN
Download sequence
Identical sequences Q3V1Z0
ENSMUSP00000121298 ENSMUSP00000038379 ENSMUSP00000038379 ENSMUSP00000095710 10090.ENSMUSP00000095710 NP_001032798.1.92730 NP_951012.2.92730 XP_006537590.1.92730 XP_006537591.1.92730 XP_006537592.1.92730 XP_011248197.1.92730 XP_011248198.1.92730 XP_011248199.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]