SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038633 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038633
Domain Number 1 Region: 131-456
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.22e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000173
Further Details:      
 
Domain Number 2 Region: 461-597
Classification Level Classification E-value
Superfamily Ricin B-like lectins 9.04e-22
Family Ricin B-like 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038633   Gene: ENSMUSG00000033316   Transcript: ENSMUST00000040001
Sequence length 604
Comment pep:known chromosome:GRCm38:5:110544345:110621382:1 gene:ENSMUSG00000033316 transcript:ENSMUST00000040001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVARKIKTLLTVNILVFVGIILFSVYCRLQDRSEALVQVVRGTDRRMRNRLSKASALAD
REAILQRLDHLEEVVYNQLNGLAKPIGLVEGPGGLGQGGVAATLQDDSQETEGKFEDFGY
NAQLSDRISLDRTIPDYRPKRCRQITYSEDLPQISVVFIFVNEALSVILRSVHSVVNHTP
SQLLKEVILVDDNSDNVELKFNLDQYVHKRYPGLVKVVRNSRREGLIRARLQGWKVATAP
IVGFFDAHVEFNTGWAEPALARIQEDRRRIILPAIDNIKYSTFEVQQYASAAHGYNWGLW
CMYIIPPQDWLDRGDESAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGAENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDDFKSHVYMAWNIP
MTNPGVDFGDVSERLALREKLKCRSFKWYLENVYPEMRIYNNTLTYGEVRNSKASGYCLD
QGAEDDDRAILYPCHGMSSQLVRYSAEGLLQLGPLGSTAFLPDSKCLVDDGRGRMPTLKK
CEDVARPTQRLWDFTQSGPIVSRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWMIRNWIK
HARH
Download sequence
Identical sequences G3X942
ENSMUSP00000038633 ENSMUSP00000038633 NP_938048.2.92730 10090.ENSMUSP00000038633 ENSMUSP00000038633

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]