SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000038924 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000038924
Domain Number 1 Region: 64-309,423-488
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-39
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000038924   Gene: ENSMUSG00000039048   Transcript: ENSMUST00000043805
Sequence length 493
Comment pep:known chromosome:GRCm38:9:35204208:35210980:-1 gene:ENSMUSG00000039048 transcript:ENSMUST00000043805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRALRLGLGPGLPYRGLRTRKGGFTLDWDAKVSDFKKKVDSILPGKKYEVLYDTSHLP
PEQADVVIIGGGILGLSVAFWLKKLESRRGAIRVLVVEQDHTYSRASSTGPSVGGIWQQF
SVPENVQLSLFSINFLRNINEYLAVVDAPPVELQFNPSGCLLLASEKDAATLENNVKMQR
QEGAKVCLMSPEQLQTKFPWINVEGVALASYGLEDEGWFDAWSLLQGLRRKVQSMGVFFC
QGEVTRFITSSTPMKTPTGEHVVLRRINNVHVKMDKSLEYQPVECAVVINAAGAWSGKIA
ELAGVGKGLPGTLQGTKLPVEPRKRYVHLWHCPQGPGLETPLVADISGVYFRREGLGSNY
LGGCSPTEEEEPDPTNLNVDHDFFQNKVWPHLVQRVPSFKTLEHLLHLQVQSAWAGYYDY
NTFDQNGVVGPHPLVVNMYFATGFSGRGLQHAPGIGRAVAEIMLEGHFKTIDMSPFLFTR
FYLGEKLQEYNIL
Download sequence
Identical sequences 10090.ENSMUSP00000038924 ENSMUSP00000038924 ENSMUSP00000117147 ENSMUSP00000038924 NP_758495.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]