SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040360 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040360
Domain Number 1 Region: 103-223
Classification Level Classification E-value
Superfamily PX domain 0.0000000000000157
Family PX domain 0.0047
Further Details:      
 
Domain Number 2 Region: 304-358
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000236
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 902-932
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000349
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040360   Gene: ENSMUSG00000061410   Transcript: ENSMUST00000046386
Sequence length 956
Comment pep:known chromosome:GRCm38:8:121598703:121652901:-1 gene:ENSMUSG00000061410 transcript:ENSMUST00000046386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLNSGGGGGGGGGGGGKSAPGPSGALPTCSACHKM
APRTETPVSSISNSLENALHTSAHSTEESLPKRPLGKHGKVSVEKIDLKGLSHTKNDRSV
ECSFEVLWSDSSITSVTKSSSEVTEFISKLSQLCPEENLDKLIPCLAGPDSFYVERNHVD
LEAGLRFLASAPSHTLKHDHVRKFFSSSSPSQQLQSPSPGNPSLPKVGAVMGVSGRPVCG
VAGIPSSQSSAQHHLQHSASTSASLPHCSHTGGTGSALAYRTQVDNSPTILMPSSLQTPQ
PQEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELE
KEKSERRCLNSSAPSLVTSSGVARVTPTSHVGPVQPGRSSSHASELRVEVEPPAHQLPRE
GSSSEYSSSSSSPMGVQVREESSDSAEESDRRVDIHVEGTEKEKPVMLLAHFPSSSARPT
AQVLPVQNETGSSPAAHHPLPPQLMPAASHLAPVRMLNSVHKSDRGGADVKLLSSSVHSL
LSLEERNKGPGPRSGTKVDKSFGGAVLDPLPSAAPHPPGQGLSGLVENNAVSPTVSFGPR
AKVVHAATLDRVLKTAQQPALTVESSSATTGTPSTVLHVARPPIKLLLASSVPADAAIAG
QTSCPNNGQISVPPAIMNPRTALYTANTKVAFSAVSSVPVGPLQGSFCANSNTASPSSHP
STSFASMASLPSCPAPSSSPALSSVPESSFYSGGAGSSSPGNIPASSQSHHHHHHHQQPP
APPQPAPPPPGCIVCTSCGCSGSCGSNGLTVSYANYFQHPFSGPSVLTFPFLPFSPMCGN
GYVSTQQYGGGSAFPVVHTPYNGSVTPDPVLGGQSTFAVPPMQNFMAGTAGVYQAQGLVG
STNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences A2RTC2 Q8VIG0
ENSMUSP00000040360 ENSMUSP00000040360 NP_543131.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]