SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000040486 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000040486
Domain Number 1 Region: 299-357
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000109
Family SAM (sterile alpha motif) domain 0.00081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000040486   Gene: ENSMUSG00000030602   Transcript: ENSMUST00000040531
Sequence length 687
Comment pep:known chromosome:GRCm38:7:28399549:28598144:-1 gene:ENSMUSG00000030602 transcript:ENSMUST00000040531 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMFRDQVGILASWFKGWNECEQTVALLSLLKRVTRTQARFLQLCLEHSLADCNDIHLLES
EANSAAIVSQWQQESKEKVVSLLLSHLPLLQPGNTEAKSEYMRLLQKVLAYSIESNAFIE
ESRQLLSYALIHPATTLEDRNALALWLSHLEERLASGFRTRPEPSYHSRQGSDEWGGPAE
LAPGEAGPGWQDKPPRENGHVPFHPSSSVPPAINSIGSNANTGLPCQIHPSPLKRSMSLI
PTSPQAPGEWPSPEELGARAAFTTPDHAPLSPQSSVASSGSEQTEEQGSSRNTFQEDGSG
MKDVPSWLKSLRLHKYAALFSQMSYEEMMTLTEQHLESQNVTKGARHKIALSIQKLRERQ
SVLKSLEKDVLEGGNLRNALQELQQIIITPIKAYSVLQATPTAKDEGRGEPLLPGAEPPL
THPGSDKGTEAKDPPAAENYPPPPAPAPSDSSEPAPAPVADGDIPSQFTRVMGKVCTQLL
VSRPDEENITSYLQLIEKCLTHEAFTETQKKRLLSWKQQVLKLLRTFPRKAALDMQSYRQ
QKGWAFGSNSLPIAGSVGMGVARRTQRQFPMPPRALPPGRMGLLSPSGIGGVSPRHALTS
PSLGGQGRQNLWFANPGGSNSMPSQSRSSVQRTHSLPVHSSPQAILMFPPDCPVPGPDLE
INPTLESLCLSMTEHALGDGTDKTSTI
Download sequence
Identical sequences G5E8A7
ENSMUSP00000040486 ENSMUSP00000040486 ENSMUSP00000040486 10090.ENSMUSP00000040486 NP_778186.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]