SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041087 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041087
Domain Number 1 Region: 1263-1405
Classification Level Classification E-value
Superfamily PH domain-like 1.22e-51
Family Phosphotyrosine-binding domain (PTB) 0.000000156
Further Details:      
 
Domain Number 2 Region: 297-424
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.89e-35
Family PLC-like (P variant) 0.0058
Further Details:      
 
Domain Number 3 Region: 129-295
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.06e-25
Family Dual specificity phosphatase-like 0.00024
Further Details:      
 
Domain Number 4 Region: 1131-1257
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-23
Family SH2 domain 0.002
Further Details:      
 
Domain Number 5 Region: 23-80
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000703
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041087   Gene: ENSMUSG00000037003   Transcript: ENSMUST00000046144
Sequence length 1407
Comment pep:known chromosome:GRCm38:15:102102988:102116391:1 gene:ENSMUSG00000037003 transcript:ENSMUST00000046144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSSGPVERLLRALGRRDSSRATSRPRKAEPHSFREKVFRKKTPVCAVCKVTIDGTGVSC
RVCKVATHRKCEAKVTSSCQALPPAELRRSTAPVRRIEHLGSTKSLNHSKQRSTLPRSFS
LDPLMERRWDLDLTYVTERILAAAFPARPDEQRHRGHLRELAHVLQSKHRDKYLLFNLSE
KRHDLTRLNPKVQDFGWPELHAPPLDKLCSICKAMETWLSADPQHVVVLYCKGSKGKLGV
IVSAYMHYSKISAGADQALATLTMRKFCEDKVATELQPSQRRYVSYFSGLLSGSIRMNSS
PLFLHYVFVPVLPAFEPNTGFQPFLKIYQSMQLVYTSGVYRIAGPGPQQLCISLEPALLL
KGDVMVTCYHKGGQGTDRTLVFRVQFHTCTIHGSRLTFPKDQLDEAWADERFPFQASVEF
VFSSSPEKVKGNTPRNDPSVSVDYNTTEPAVRWDSYENFNQHHEDSVDGALAHTRGPLDG
SPYAQVQRVPRQTPPAPSPELPPPPMLSVSSDSGHSSTLTTEHTAESPGRPPPTAAERQE
LDRLLGGCGVASAGRGAGRETAILDDEEQPSVGGGLHLGMYSGHRPGLSRRCSCRQGFRE
PCGVPNGSYYRPEGTLERRRPPYGGYEGHPQGYAEASVEKRRLCRSLSEGPYPYAPELGK
PANGDFGYRPAGYREVVILEDPGVPALCSCPACEEKLALPTAALYGLRLEREAAEGWSSE
VGKPLLHPVRPGHPLPLLVPACGHHHAPMPDYGCLKPPKVGEEGHEGCSYAVCSEGRYGH
SGYPALVTYGYGGAVPSYCPAYGRAPHSCGSPSEGRGYPSPGAHSPRAGSVSPGSPPYLQ
PRKLGYEISAEDGRDKYPLSGHLASTGPLASTELFPPVSESPEPSWRDGSSGHSTLPRSP
RDPQCSASSELSGPSTPLHTSSPVQGKESNRRQDTTRSPSLAPTQRLSPGEALPSVVQGV
AEKTPELLTSSRPEQLDPSPFSQTSAPGSPNGWPQERSPGGHTNSASPRSPVPTTLPGLR
HAPWQGPRGTSDSPDGSPLTPVPTQMPWLVGSPEPPQSSPTPAFPLATSYDANGPIQPPL
PEKRHLPGSGQQPSPPARSTNQHVTFASPLPDVTQPPEHPLQENQSNVKFVQDTSKFWYK
PHLSRDQAIALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPSEQLVRHF
LIETGPKGVKIKGCPTEPYFGSLSALVSQHSISPISLPCCLRIPSKDPLEETPEAPVPTN
MSTAADLLRQGAACSVLYLTSVETESLTGPQAVAKASSAALSCSPVPVPAIVHFKVSAQG
ITLTDNQRKLFFRRHYPVNSITFSSTDPQDRRWTNPDGATSKIFGFVAKKPGSPWENVCH
LFAELDPDQPASAIVTFITKVLLGQRK
Download sequence
Identical sequences ENSMUSP00000041087 ENSMUSP00000129146 ENSMUSP00000041087 XP_011243839.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]