SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000041920 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000041920
Domain Number 1 Region: 1334-1472
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 240-341
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000982
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000041920   Gene: ENSMUSG00000041570   Transcript: ENSMUST00000048309
Sequence length 1478
Comment pep:known chromosome:GRCm38:1:136268123:136346104:-1 gene:ENSMUSG00000041570 transcript:ENSMUST00000048309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPREMRRTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELGDPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVIQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMISIEKVIACAQQYSAFFQATDLPYDIEDA
VMYWMNKVNEHLKDIMEQEQKSKEHHPAEAPGGQKAGLEHTFCHSPILIALIARYRKEQT
LLKQLPCIPLVENLLKDGTDGCALAALIHFYCPAVVRLEDICLKETMSLADSLYNLQLIQ
EFCQEYLNHCCHFSLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVVRPQGAEP
AKDVPSVPVLNAAKRNIRDSSSSSDFSSRYTRPQTHSSASGGIRRSSSMSYVDGFIGTWP
KEKRTSVHGVSFDISFDKEDSAQSSTPNRGIIRSVSNEGLTLNNSRASKHIRKNLSFKPV
NGEEEESIEEELHVDPHGDLQSPMPLNTNELNSNESTHYKLPNGALQNRVLLDEFGNQIE
TPSIEEALQIIHDTERPPHTPRPDQIANGFFLHGQDLSILNSNIKLNQSSPDNLTDTKGA
LSPITDTTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKLLQDYDLRASNPR
EALSPCPSTISTKSQPGSSASSSSGVKMTSFAEQKFRKLNHTDGKSSGSSSQKTTPEGSE
LNIPHVVSWAQIPEEAGVAPGRDTTQLLASEMVHLRMRLEEKRRAIEAQKKKMEAAFTKQ
RQKMGRTAFLTVVKKKGEGISPLREEAAGAEDEKVYTDRAKERESQKMDGQRSKSLADIK
ESMETPPGRWLKSPTTPVDPERQWNLTSPSEETLNEGEILEYTKSIEKLNSSLHFLQQEM
QRLSLQQEMLMQMREQQAWVISPPQPSPQKQIRDFKPRQAGLSSAAAPFSSDSPRPTHPS
PQSSTRKSASFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFSPSQVPIQTRSF
VCFGDDGEPQKEPKQKEEIKKEPSECKGTLGPCDHNPGEKEIKPVESTVSEVLSQPITET
VCVTPNEDQLSQPTEPPPKPVFPPTAPKNVNLIEVSLSDLKPPEKADVSVEKLDGESDKE
QFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQLEAEMEHKKEET
RRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQAAKQKKQRPKSIHR
DHIESPKTPIKGPPVSSLSLASLNTGDSESVHSGKRTPRSESVEGFLSPSRCGSRNGEKD
WENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVNEGQKKKILEEME
KSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIEGLYKYNSDRKQF
SHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences H7BX08
10090.ENSMUSP00000041920 NP_001074829.1.92730 ENSMUSP00000041920 ENSMUSP00000041920 ENSMUSP00000041920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]