SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000042151 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000042151
Domain Number 1 Region: 532-603
Classification Level Classification E-value
Superfamily RUN domain-like 0.0000000314
Family RUN domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000042151   Gene: ENSMUSG00000035007   Transcript: ENSMUST00000040561
Sequence length 615
Comment pep:known chromosome:GRCm38:11:101425085:101435673:1 gene:ENSMUSG00000035007 transcript:ENSMUST00000040561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVEVATELGTVVTAVGPKAKDEEEEEEEEESLPPCETVRWAPVGAVAEAGPGAATFSE
AAAAEEPGAAPGSPSDATVRTLRRLEAERRQLDSALLALSSHFAQVQFRLRQVVRGAPAE
QQRLLRELEDFAFRGCPHVLGYEGLADPCGGDESDVLPGDRPRVRGEDQSEQEKRERLET
QREKQKELILQLKTQLDDLETFAYQEGSYDSLPQSVVLERQRVIIDELIKKLDMNLNEDI
SSLSTEELRQRVDAAVAQIVNPVRVKEQLVEQLKTQIRDLEMFISFIQDEVGSPLQTGGH
CECQASGKVGIGSTRVGGSTLPPGPGKAKAEDAKRARETGLHLMRRALAVLQIFTVSQLG
CATGQIPQTLWQRSQADRDYSHLLKRLEVSVDRVKQLALRHQPHDHVITSANLQDLSLGG
KDELTTVVRKELTVAVRDLLAHGLYASSSGMSLVMAPLACLLPVFSSAPETMHPWELFVK
YYHAKNGRAYVESPARKLSQSFALPIMGDTAVTPKQSLLTAIHLVLTEHDPFKRSADSEL
KALVCMALNEQRLVSWVNLICKSGSLIEPHYQPWSYMAHTGFESALNLLSRLSSLKFSLP
VDLAVRQLKNIKDAF
Download sequence
Identical sequences Q0VDN7
ENSMUSP00000042151 NP_766154.2.92730 ENSMUSP00000042151 ENSMUSP00000042151 10090.ENSMUSP00000042151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]