SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000042883 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000042883
Domain Number 1 Region: 223-478
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.86e-63
Family Eukaryotic proteases 0.000000149
Further Details:      
 
Domain Number 2 Region: 49-166
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.1e-24
Family Spermadhesin, CUB domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000042883
Domain Number - Region: 185-232
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000275
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000042883   Gene: ENSMUSG00000038527   Transcript: ENSMUST00000049124
Sequence length 482
Comment pep:known chromosome:GRCm38:6:124493113:124510643:1 gene:ENSMUSG00000038527 transcript:ENSMUST00000049124 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGFRGLVPELENSLWSSPTTSCMSKMCWWLLWGILHTCPTQASVLLAQQSPQQLTSPGY
PEPYLKGQESHTDIEAPEGFAVRLTFQDFDLEPSPDCEGDSVTISTGGTDATRLCGRQGS
PLGNPPGHREFVSSGRSLRLTFQAHSSSKSKITHLHKGFLALYQAVAVNQPNGDTEAVTT
PGAPKIQNHCQDPYYKADQTGTLSCPSSWKWKDRQDGGEVPECVPVCGRPVVPLAENPNT
FGSSRAKLGNFPWQAFTSIYGRGGGALLGDRWILTAAHTIYPKDSIYLRRNQNVEVFLGH
TDIDELLKLGNHPVRRVVVHPDYRQHESHNFNGDIALLELEQRVPLGPNLLPVCLPDNET
LYHSGLWGYVSGFGVEMGWLTTKLKYSKLPVAPREACEAWLHQRQRTEVFSDNMFCVGEE
MQVNSVCQGDSGSVYVVWDDLALRWVATGIVSWGIGCGKGYGFYTKVLSYMDWIKRVIEG
KD
Download sequence
Identical sequences Q3UZ09
ENSMUSP00000042883 ENSMUSP00000042883 NP_851989.3.92730 ENSMUSP00000042883 10090.ENSMUSP00000042883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]