SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000044405 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000044405
Domain Number 1 Region: 3-231
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.3e-51
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0026
Further Details:      
 
Domain Number 2 Region: 297-486
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000000000000022
Family FAD/NAD-linked reductases, N-terminal and central domains 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000044405   Gene: ENSMUSG00000040170   Transcript: ENSMUST00000045902
Sequence length 535
Comment pep:known chromosome:GRCm38:1:162874317:162898712:-1 gene:ENSMUSG00000040170 transcript:ENSMUST00000045902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKKVVVIGAGVSGLISLKCCVDEGLEPTCFERTEDIGGLWRFKENVEDGRASIYRSVIT
NTSKEMSCFSDFPMPEDFPNFLHNSKLLEYFRIFAKKFDLLKYIQFQTTVISVKKRPDFA
SSGQWEVYTQSNGKEQRTVFDAVMVCSGHHIQPHLPLKSFPGIERFRGQYFHSREYKHPV
GFEGKRILVVGIGNSAADIASELSKTAAQVFVSTRHGSWVMSRISEDGYPWDMVFHTRFS
SMLRNVLPRTVVKWMMEQQMNRWFNHENYGLVPQNKYLMKEPVLNDDLPSRLLYGAIKVK
TRVKELTETAVVFEDGTVEEDVDIIVFATGYTFSFSFLEDSLVKVEDNRVSLYKAMFPPH
LEKPTLACIGLIQPLGSIFPTVELQARWATRVFKGLCSLPSETTMMADIVERNEKRVNLF
GKSQSQILQTNYVDYLDELALEIGAKPDFVSLFFKDPKLAVKLYFGPCNSYQYRLVGPGQ
WEGARNAILTQKQRILKPLKTRTLQSSDSAPVSFLLKILGLLAVVLAFFFQLQGF
Download sequence
Identical sequences Q8K2I3
10090.ENSMUSP00000107135 ENSMUSP00000044405 NP_061369.2.92730 XP_006497012.1.92730 ENSMUSP00000044405 ENSMUSP00000044405 ENSMUSP00000107135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]