SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047639 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047639
Domain Number 1 Region: 388-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.71e-35
Family Calponin-homology domain, CH-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 87-241,387-437
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.96e-19
Family FAD/NAD-linked reductases, N-terminal and central domains 0.073
Further Details:      
 
Domain Number 3 Region: 973-1005
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000185
Family LIM domain 0.013
Further Details:      
 
Domain Number 4 Region: 1006-1035
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000314
Family LIM domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047639   Gene: ENSMUSG00000038244   Transcript: ENSMUST00000037991
Sequence length 1102
Comment pep:putative chromosome:GRCm38:7:112271299:112353975:1 gene:ENSMUSG00000038244 transcript:ENSMUST00000037991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQASQVFENFVQATTCKGTLQAFNILTCLLDLDPLDHRNFYSQLKSKVNTW
KAKALWHKLDKRGSHKEYKRGKACSNTKCLIVGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALMLGVEVHVN
VEFVRVLEPPEDQENQKVGWRAEFLPADHALSDFEFDVIIGADGHRNTLEGFRRKEFRGK
LAIAITANFINRNSTAEAKVEEISGVAFIFNQKFFQDLKEETGIDLENIVYYKDSTHYFV
MTAKKQSLLDKGVILNDYIDTEMLLCSENVNQDNLLSYAREAADFATNYQLPSLDFAINH
NGQPDVAMFDFTSMYASENAALMRERQAHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLEVLAERESLYRLLPQTTPENINKNFEQYTLDPATRYPNLNLHCVR
PHQVKHLYITKEMDRFPLERWGSVRRSVSLSRRESDIRPNKLLTWCQQQTKGYQHVRVTD
LTTSWRSGLALCAIIHSFRPELINFDSLNEDDAVENNQLAFDVAKREFGILPVTTGKEMA
STQEPDKLSMVMYLSKFYELFRGTPLRPMDSWRKNYGENADFGLGKTFIQNNYLNLTLPR
KRTPRVDTQTEENDMNKRRRQGFNHLEELPSFSSRSLGSSQEYAKESGSQNKVKHMANQL
LAKFEENTRNPSVVKQDCRRVSGIGKPVLCSASRPPGTSCCPKLEESTPRLPPPLKRQFS
STVATGQVLRELNQVPASGECPSRPWRARAKSDLQLGGVENLATLPRTCQGALALSGVLR
RLQQVEEKVLQKRAQNLANREFHTKNIKEKAAHLASMFGHGDLPQDKLLSKRVPHAHPPS
PPSCLPSPHPAAASSPPAADSVSPARKLTVGKVSSGIGAAAEVLVNLYLNDHRPKTQATS
PDLESPRKAFPLSLGGRDTCYFCKKRVYMIERLSAEGHFFHQECFRCSVCSATLRLAAYA
FDCDEGKFYCKPHFVHCKTSSKQRKRRAELNQQREEEGTWQEQEAPRRDVPTESSCAVAA
ISTPEGSPPVRFSLPVLHPLLG
Download sequence
Identical sequences ENSMUSP00000102259 NP_001180234.1.92730 XP_006508017.1.92730 ENSMUSP00000047639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]