SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000047900 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000047900
Domain Number 1 Region: 168-319
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.44e-44
Family Dual specificity phosphatase-like 0.0000193
Further Details:      
 
Domain Number 2 Region: 3-144
Classification Level Classification E-value
Superfamily Rhodanese/Cell cycle control phosphatase 1.02e-23
Family Cell cycle control phosphatase, catalytic domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000047900   Gene: ENSMUSG00000034765   Transcript: ENSMUST00000038287
Sequence length 384
Comment pep:novel chromosome:GRCm38:19:53529109:53542431:1 gene:ENSMUSG00000034765 transcript:ENSMUST00000038287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVTSLDGRQLRKMLRKEAEARCVVLDCRPYLAFAASSVRGSLNVNLNSVVLRRARGGAV
SARYVLPDEAARARLLQEGGGGVAAVVVLDQGSRHWQKLREESAARVVLTSLLACLPAGP
RVYFLKGGYETFYSQYPECCVDVKPTSQEKIEGERSLLSQCGKPVLSVAYRPAYDQGGPV
EILPFLYLGSAYHASKCEFLANLHITALLNVSRRTSEACTTHLHYKWIPVEDSHTADISS
HFQEAIDFIDCVREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFRLKEAFDYVKQRRSVV
SPNFGFMGQLLQYESEILPSTPTLQPPSCQGEAASSTFIGHLQTLSPDMQGTYCTFRTSV
LAPVPTHSTVPELHRSPVATATSC
Download sequence
Identical sequences Q1HL35
NP_001078859.1.92730 10090.ENSMUSP00000047900 ENSMUSP00000047900 ENSMUSP00000047900 ENSMUSP00000047900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]