SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000049902 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000049902
Domain Number 1 Region: 509-768
Classification Level Classification E-value
Superfamily NHL repeat 4.97e-47
Family NHL repeat 0.00000725
Further Details:      
 
Domain Number 2 Region: 359-455
Classification Level Classification E-value
Superfamily E set domains 1.67e-22
Family Filamin repeat (rod domain) 0.0033
Further Details:      
 
Domain Number 3 Region: 135-197
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000183
Family B-box zinc-binding domain 0.002
Further Details:      
 
Domain Number 4 Region: 44-118
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000353
Family RING finger domain, C3HC4 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000049902   Gene: ENSMUSG00000027993   Transcript: ENSMUST00000054990
Sequence length 770
Comment pep:putative chromosome:GRCm38:3:84163722:84270791:-1 gene:ENSMUSG00000027993 transcript:ENSMUST00000054990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRSGRYGTQQRAGSRTAGPPCQWSRMASEGASIPSPVVRQIDKQFLICSICLERYKNPK
VLPCLHTFCERCLQNYIPAHSLTLSCPVCRQTSILPEKGVAALQNNFFITNLMDVLQRTP
GSNGEDSSILETVTAVAAGKPLSCPNHDGNVMEFYCQSCETAMCRECTEGEHAEHPTVPL
KDVVEQHKASLQVQLDAVNKRLPEIDSALQFISEIIHQLTNQKASIVDDIHSTFDELQKT
LNVRKSVLLMELEVNYGLKHKVLQSQLDTLLQGQESIKSCSNFTAQALNHGTETEVLLVK
KQMSEKLNELADQDFPLHPRENDQLDFIVETEGLKKSIHNLGTILTTNAVASETVATGEG
LRQTIIGQPMSVTITTKDKDGELCKTGNAYLTAELSTPDGSVADGEILDNKNGTYEFLYT
VQKEGDFTLSLRLYDQHIRGSPFKLKVIRSADVSPTTEGVKRRVKSPGSGHVKQKAVKRP
ASMYSTGKRKENPIEDDLIFRVGTKGRNKGEFTNLQGVAASTSGKILIADSNNQCVQIFS
NDGQFKSRFGIRGRSPGQLQRPTGVAVHPSGDIIIADYDNKWVSIFSNDGKFKTKIGSGK
LMGPKGVSVDRNGHIIVVDNKACCVFIFQPNGKIVTRFGSRGNGDRQFAGPHFAAVNSNN
EIIITDFHNHSVKVFNQEGEFMLKFGSNGEGNGQFNAPTGVAVDSNGNIIVADWGNSRIQ
VFDGSGSFLSYINTSADPLYGPQGLALTSDGHVVVADSGNHCFKVYRYLQ
Download sequence
Identical sequences E9QKC6
ENSMUSP00000049902 NP_001258654.1.92730 ENSMUSP00000049902 ENSMUSP00000103319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]