SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050454 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050454
Domain Number 1 Region: 3864-4042
Classification Level Classification E-value
Superfamily Fibronectin type III 1.24e-35
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 2 Region: 4260-4436
Classification Level Classification E-value
Superfamily Fibronectin type III 7.51e-35
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 3 Region: 4724-4923
Classification Level Classification E-value
Superfamily Fibronectin type III 9.85e-32
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 4 Region: 1698-1886
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.86e-31
Family Laminin G-like module 0.0022
Further Details:      
 
Domain Number 5 Region: 4521-4727
Classification Level Classification E-value
Superfamily Fibronectin type III 4.01e-31
Family Fibronectin type III 0.0049
Further Details:      
 
Domain Number 6 Region: 2714-2916
Classification Level Classification E-value
Superfamily Fibronectin type III 1.44e-30
Family Fibronectin type III 0.0041
Further Details:      
 
Domain Number 7 Region: 3582-3756
Classification Level Classification E-value
Superfamily Fibronectin type III 2.04e-30
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 8 Region: 2133-2320
Classification Level Classification E-value
Superfamily Fibronectin type III 2.31e-30
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 9 Region: 2319-2524
Classification Level Classification E-value
Superfamily Fibronectin type III 2.16e-27
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 10 Region: 967-986,1515-1671
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.32e-26
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 11 Region: 1239-1285,1313-1397
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-25
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 12 Region: 1050-1240
Classification Level Classification E-value
Superfamily Fibronectin type III 1.4e-25
Family Fibronectin type III 0.0033
Further Details:      
 
Domain Number 13 Region: 1896-2047
Classification Level Classification E-value
Superfamily Fibronectin type III 6.16e-24
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 14 Region: 2522-2664
Classification Level Classification E-value
Superfamily Fibronectin type III 6.07e-23
Family Fibronectin type III 0.0051
Further Details:      
 
Domain Number 15 Region: 3448-3581
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-23
Family Fibronectin type III 0.0027
Further Details:      
 
Domain Number 16 Region: 4141-4256
Classification Level Classification E-value
Superfamily Fibronectin type III 1.62e-19
Family Fibronectin type III 0.0019
Further Details:      
 
Domain Number 17 Region: 3011-3141
Classification Level Classification E-value
Superfamily Fibronectin type III 1.77e-18
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 18 Region: 128-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-16
Family Leech intramolecular trans-sialidase, N-terminal domain 0.073
Further Details:      
 
Domain Number 19 Region: 1418-1501
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000299
Family Fibronectin type III 0.0067
Further Details:      
 
Domain Number 20 Region: 4430-4525
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000146
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 21 Region: 2041-2129
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000216
Family Fibronectin type III 0.003
Further Details:      
 
Domain Number 22 Region: 3768-3859
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000057
Family Fibronectin type III 0.004
Further Details:      
 
Domain Number 23 Region: 2907-3011
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000879
Family Fibronectin type III 0.0038
Further Details:      
 
Domain Number 24 Region: 4051-4132
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000348
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 25 Region: 844-894
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.017
Further Details:      
 
Domain Number 26 Region: 897-940
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000809
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 27 Region: 744-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000106
Family Laminin-type module 0.008
Further Details:      
 
Domain Number 28 Region: 638-688
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000012
Family Laminin-type module 0.0056
Further Details:      
 
Domain Number 29 Region: 691-741
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000024
Family Laminin-type module 0.0069
Further Details:      
 
Domain Number 30 Region: 792-839
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000251
Family Laminin-type module 0.013
Further Details:      
 
Domain Number 31 Region: 572-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.04
Further Details:      
 
Domain Number 32 Region: 999-1047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000229
Family Laminin-type module 0.013
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000050454
Domain Number - Region: 515-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000586
Family EGF-type module 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050454   Gene: ENSMUSG00000026609   Transcript: ENSMUST00000060479
Sequence length 5193
Comment pep:known chromosome:GRCm38:1:188263034:188965041:1 gene:ENSMUSG00000026609 transcript:ENSMUST00000060479 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHYLALSPGFLCYTIKTLILAYLASVLVLAASQGVFPRLENVGAFRKVSTVPTHATCGFP
GPSTFCRSPVAAEHVQLCTERLCIQDCPYRSASPLYTALLEGLRSCIPADDGDLHPYSRS
SSVSFMFGSHQNCPSLRAPRLAAELTLAVWLKLEQGGTMCVIEKTVDGQIVFKVTISEKE
TMFYYRTVNGLQPPIKVMTPGRILMKKWIHLTVQVHQTAISFFVDGLEENSTAFDTRTLH
DSVTDSVSSVIQVGQSLNGSEQFVGRMQDFRLYNVSLTNREILEVFSGDFPHLHIQPHCR
CPGSHPRVHPSVQQYCIPNGAGDTPEHRMSRLNPEAHPLSFINDDDVATSWISHVFTNIT
QLYEGVAISIDLENGQYQVLKVITQFSSLQPVAIRIQRKKADSSPWEDWQYFARNCSVWG
MKDNEDLENPNSVNCLQLPDFIPFSHGNVTFDLLTSGQKHRPGYNDFYNSSVLQEFMRAT
QIRLHFHGQYYPAGHTVDWRHQYYAVDEIIVSGRCQCHGHAETCDRTRRPYRCLCSPHSF
TEGPQCDRCSPLYNDKPFRSGDNVNAFNCKPCQCHGHASSCHYDASVDPFPLEHNRGGGG
VCDDCQHHTTGRHCESCQDYFYRPVGADPAAPDACKLCDCNRAGTRNGSLHCDPIGGQCD
CKRRVSGRQCLQCQDGFYDLQALDPDGCRPCNCNPSGTVDGDITCHQNSGQCSCKANVIG
LRCNRCNFGFKFLQSFNGDGCEPCQCNLHGSVNQLCDPLSGQCACKKEAKGLKCDSCREN
FYGLPWSACEVCDCSKAGSQPGTVCDTETGQCVCKPNVGGRQCSQCKAGYFNLYQNDSHL
CLTCNCEKMGTVNGSLRCDKSTGQCPCKLGVTGLRCHQCKPHRFNLTMDNPQGCQACDCD
SLGTLPGSMCDPISGQCLCLPHRQGRRCEQCQPGFYSSPSNATGCLPCLCHTAGAVSHIC
NSVTGQCSCHDPSTTGRSCHQCQESYFRFDPLTGRCRPCHCHVAGASNGTCDAVTGQCFC
KEFVTGSKCDTCVPGASHLDVNNLLGCSKTPSQQPPPRGWVQSSSTINVSWSPPECPNAH
WLTYTLFRNGSEIYTTEDEHPYYTQYFLDTSLSPHTAYSYYIETSNVHSSTRSIPVIYET
KPEVSEGHLNLTHIIPVGSDSITLTWTGLSNSSDPVAKYVLSCTPVDSTEPCVSYEGPET
SATIWNLVPFTQYCFSVQGCTNESCFYSLPIIVTTAQAPPQTQGPPTVWKISPTELRIEW
SPPVDSNGIIISYELYMRRWLSTEESLVFESHGLVSSHSALQSVNPSKNLLQQPQASTFI
SGLEPHTEYAFRVLAVNMAGRVSSAWASERTGESVPVFMAPPSVSPLSPHSLSVSWEKPA
ENFTRGEIIGYKISMVSEHFPLHDVPVMCSKMVHFAKSQDQSYIVRGLEPYRTYSFTVSL
CDSVGCVTSALGSGQTLAAAPAQLRPPMVTGVNSTTVHIRWLPPAGVNGPPPLYHLERKK
SSLPAATAAVTKGTRFVGHGYCRFPRTAHADFIGIKASFRTRVPEGLILLALSPGDQEEY
FTLQLKNGRPYFLYNSQGTLVEVTPTDDPSQGYRDGEWHEIIAVRHQAFGQITLDGQYTG
SSSSLNGSSVTGGYTGLFVGGVPQGHSVLQKRLEIIQRGFVGCLKDVFIMKGYSPSGTWL
PLDWQSSEEQVNVHPSWEGCPTNLEEGVQFLGAGFLELPSDTFHAAKDFEISLKFQTDQL
NGLLLFIHNTEGPDFLAVELKRGLLSFKFNSSLVFTRVDLRLGLADCDGKWNTVSIKKEG
SVVSVRVNALKKSTSQAGGQPLLVNSPVYLGGIPRELQDAYRHLTLEPGFRGCVKEVAFA
RGVVVNLASVSSRAVRVNQDGCLSSDSTVNCGGNDSILVYRGSQQSVYESGLQPFTEYLY
RVTASHEGGAVSSDWSRGRTLGTAPQSVPTPSRAQSINGSSVEVAWNEPAVVKGVLEKYV
LKAYSEDSSQPRVPSASTELHDTSTHSGVLIGLHPFHSYTVTLTACSRAGCTESSQALSI
STPQEAPQEVQAPVAVALPNSLSFFWSLPRQANGIITQYSLYVDGRLVYTGKGQNYTVTD
LRVFAAYEIIVGACTQAGCTNSSQVILHTAQLPPEQVDPPGLTVLDSRTIHVRWKQPRQL
NGILERYILYILNPIHNSTMWSVVYNSTEKLQAHVLHHLSPGGLYLIRLRVCTGGGCTTS
EPSQALMEETIPEGVPAPRAHSYSPDSFNISWTEPEYPNGVITTYELYLDDTLIHNSSGL
SCHAYGFDPGSLHTFQVQACTAKGCALGPLVGNRTLEAPPEGVVNVLVKPEGSREAHVRW
DAPAHPNGRLTYSVHFTGSFYADQAGDNYTLLSGTKTIRGIEGSRLWVLVDGLVPCSHYM
VQVNASNSRGSVLSDPVSVEMPPGAPDGLLSPRLAAAAPTSLQVVWSTPARNNAPGSPRY
QLQMRPGPSTHGRLELFPIPSASLSYEVTGLQPFTVYEFRLVATNGFGTAYSAWTPLMTT
EDKPGPIDAPILINVKARMLSVIWRQPAKCNGAITHYNIYLHGRLYLTVSGRVTNYTVVP
LHPYKAYHFQVEACTSQGCSKSPSSETVWTLPGNPEGIPSPQLFPYTPTSIIVTWQPSAH
LDLLVENVTIERRVKGKKEVRNLVTLARSQAMKFIDNDPALRPWTRYEYRVLGSTLDGGT
NSSAWVEVTTRPCRPSGVQPPTVRVLAPDTVEVSWKAPLMQNGDILSYEIRMPEPLIKMT
NMSSIMLSHLVKHLIPFTNYSVTIVACSGGNGYLAGCTESPPTLATTHPAPPQELAPLSV
ILLSESDVGISWQPPSKPNGPNLRYELLRCKIQQPLASNPPEDLNLWHNIYSGTRWFYKD
KGLSRFTTYEYKLFVHNSVGFTPSREVTVTTLAGSPERGATVTASILNHTAIDVRWKKPT
FQDLQGDVEYYTLFWSSGTSEESLKIFPDVDFHVIGQLSPNVEYQVFLLVFNGVHAINST
VVHVTMWEEEPQGMLPPEVVIINSTAVRVIWTSPSNPNAVVTESSVYVNNKLYKTGTDAP
GSFVLEDLSPFTIYDIQVEVCTKDACVKSNGTQVSTAEDTPSDISIPVIRGITSRSLQID
WTTPANPNGIILGYDVLRKTWRPCSETQKLTDKPRDELCKAVKCQYPGKVCGHTCYSPGT
KVCCDGLLYDPQPGYSCCEDKYIALSPNATGVCCGGRMWEAQPDHQCCSGHYARILPGEI
CCPDERHNRVSVGFGDACCGTMPYATSGSQVCCAGRLQDGYRQQCCGGEMVSQDFQCCGG
GEEGMVYSYLPGMLCCGQDYVNMSETICCSASSGESKAHVRKDDPTPVKCCGTELSPESQ
RCCDGVGYNPLKYVCSDEISAGMAMKETRVCATICPATMKATAHCGRCDFNATTHICTVM
RGPLNPTGKKAVEGLCSAAEEIVHSGDVNTHSFIDRDLKPSTVYEYRISAWNSYGRGFSQ
SVRASTREDVPEGVKAPRWARTGKHEDVIFLQWEEPMQSNGPIIHYILFRDGRERFQGTA
LSFTDTQGIQPLQEYSYQLKACTAAGCAVSCKVVAATTQRSPENVPPPNITAQSSETLHL
SWSVPEKMKDAIKAYQLWLDGKGLIYTDTSDRRQHTVTGLQPYTNYSFTLAVCTSVGCTS
SEPCVGQTLQAAPQGVWVTPRHIIINSTTVELYWNPPERPNGLISQYQLRRNGSLLLVGG
RDNQSFTDSNLEPGSRYIYKLEARTGGGSSWSEDYLVQMPLWTPEDIHPPCNVTVLGSDS
IFVAWPTPGNLLPKIPVEYSILLSGGSVTLLVFSVRHRQSAHLKNLSPFTQYEIRIQACQ
NGGCGVSPGTYVRTLEAAPVGLMPPLLKALGSSCIEVKWMPPTRPNGIITSYVVHRRPAD
TEEESLLFVWSEGALEFTDDTGTLRPFTLYEYRVRAWNSQGAVDSPWSTIQTLEAPPRGL
PAPRVQATSAHSAMLNWTEPEAPNGLISQYHVIYQERPDAAAPGSSTVHAFTVTGTSRQA
HLFGLEPFTTYHIGVVAVNSAGKVSSPWTLIKTLESAPSGLMNFTVEQREKGRALLLQWS
EPVKTNGVIKAYNIFNDGVLEYSGLGRQFLFRRLAPFTLYTLILEACTTAGCAHSVPQPL
WTEEAPPDTQMAPTIQSVGPTNVRLHWSQPASPNGKIIHYEVIRRRSEEEDWGNTTWQAD
GNTVFTEYNTQGNAWVYNDTGLQPWRQYAYRICAWNSAGHTCSSWNVVRTLQAPPDGLSP
PEISYVSMSPLQLLISWLPPRHSNGVIQGYRLQRDGVLPALNFNASTFSYMDSQLLPFST
YSYAILACTGGGCCTSEPTNITTPEVPPSEVSPPVLWDISAHQMNVSWSPPSIPNGKIVK
YLLQCDGEEHLAGQGLSFLLSNLQPSTQYNISLVACTSGGCTASRTTSAWTKEAPPENMD
PPTLHITGPESIEITWTPPRNPHGLIRSYELRRDGAIVYVGLETRYHDFTLAPGVEYSYS
VTATNSRGSVLSPLVKGQTSPSAPSGLQPPKLHSGDALELLADWDPPVRTNGKIINYTLF
VREMFEGKTRAMSINTTHSSFGTRSLTVKHLKPFHRYEVRVQACTALGCTSSEWTSTQTS
EVPPLRQPAPHLEVQTATGGFQPIVAVWWAGPLQPNGKIICFELYRRQVAAWPGTSSSLL
IYNGSFRSFMDSELLPFTEYEYQVWAVNSAGKAASNWTRCRTGPAPPEGLQAPTFHTVSS
TRAVVNISVPSRPNGNISLFRVFSNSSGTHVTLSEGTATQQTLHDLSPFTTYTIGVEACT
CFNCCSRGPTAELRTHPAPPSGLSPPQVQTLGSRMASVHWTPPLLPNGVIHSYELQLQRA
CPPDSAPRCPPSHTERKYWGPGHRASLAGLQPNTAYGVQVVAYNEAGSTASGWTNFSTKK
EMPQYQALFSVDSNASMVWVDWSGTFLLNGHLKEYVVTDGGRRVYSGLDTTLYIPRMVDK
IFFFQVTCTTDIGSVKTPLVQYDAATGSGLVLTTPGEKKGAGTKSTEFYSELWFIMVMAV
VGLILLAIFLSLILQRKIHKEPCIRERPPLVPLQKRMTPLSVYPPGETHVGLADTRLPRS
GTPMSIRSSQSVSVLRIPSQSQLSHAYSQSSLHRSVSQLMDMADKKVVTEDSLWETIMGH
SSGLYVDEEELMNAIKGFSSVTKEHTAFTDTHL
Download sequence
Identical sequences Q2QI47
NP_067383.3.92730 ENSMUSP00000050454 ENSMUSP00000050454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]