SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050832 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050832
Domain Number 1 Region: 1004-1185
Classification Level Classification E-value
Superfamily Fibronectin type III 4.35e-18
Family Fibronectin type III 0.0022
Further Details:      
 
Domain Number 2 Region: 696-765
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000358
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 753-795
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000822
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 4 Region: 907-986
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000973
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 5 Region: 791-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000292
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 6 Region: 311-354
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000891
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 386-425
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000209
Family EGF-type module 0.003
Further Details:      
 
Domain Number 8 Region: 431-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000012
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 795-904
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000013
Family Growth factor receptor domain 0.0098
Further Details:      
 
Domain Number 10 Region: 582-619
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000179
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 11 Region: 659-696
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.012
Further Details:      
 
Domain Number 12 Region: 620-660
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000653
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 13 Region: 544-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000131
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 14 Region: 351-392
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000196
Family EGF-type module 0.02
Further Details:      
 
Domain Number 15 Region: 1308-1346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.013
Further Details:      
 
Domain Number 16 Region: 275-318
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000322
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 17 Region: 472-503
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000432
Family EGF-type module 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000050832
Domain Number - Region: 507-537
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0194
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050832   Gene: ENSMUSG00000047793   Transcript: ENSMUST00000062202
Sequence length 1403
Comment pep:known chromosome:GRCm38:1:93235841:93301065:1 gene:ENSMUSG00000047793 transcript:ENSMUST00000062202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGAAWALLLAAALGLGTRGVRAAVALADFYPFGTKRGDTVTPKQDDGGSGLQPLSVPF
PFFGAEHSGLYVNNNGIISFLKEVSQFTPVAFPIAKDRCVVAAFWADVDNRRAGDVYYRE
ATDPAMLNRATEDIRRYFPELPDFSATWVFVATWYRVTFFGGSSSSPVNTFQTVLITDGR
FSFTIFNYESILWTTGTHASSGGDTDGLGGIAAQAGFNAGDGHRYFNIPGSRTADMAEVE
TTTNVGVPGRWAFRIDDAQVRVGGCGHTTSVCLVLRPCLNGGKCIDDCVTGNPSYTCSCL
AGFTGRRCHLDVNECASHPCQNGGTCTHGVNSFSCQCPAGFKGPTCESAQSPCDNKVCQN
GGQCQAESSSAVCVCQAGYTGATCETDVDECSSDPCQNGGSCVDLVGNYSCICVEPFEGP
QCETGSYLVPSPCLSNPCQNGGTCVDADEGYVCECPEGFMGLDCRERILNDCDCRNGGRC
LGANTTLCQCPPGFFGLLCEFEVTATPCNMNTQCPDGGYCMEYGGSYLCVCHTDHNISHS
LPSPCDSDPCFNGGSCDAHEDSYTCECPRGFHGRHCEKARPHLCSSGPCRNGGTCKEMGD
EYRCTCPYRFTGRHCEIGKPDSCASGPCHNGGTCFHYIGKYKCDCPPGFSGRHCEIAPSP
CFRSPCMNGGTCEDLGTDFSCYCQPGYTGHRCQAEVDCGHPEEVEHATMRFNGTHVGSVA
LYTCEPGFSLSALSHIRVCQPQGVWSQPPQCIEVDECRSQPCLHGGSCQDLIADYQCLCS
PGYEGVHCELETDECQAQPCRNGGSCRDLPRAFICQCPEGFVGIHCETEVDACASSPCQH
GGRCEDGGGAYLCVCPEGFFGYNCETVSDPCFSSPCGSRGYCLASNGSHSCTCKVGYTGK
DCTKELLPPTALRVERVEESGVSISWSPPEGTTARQVLDGYAVTYASSDGSSRRTDFVDR
SRSSHQLRALAAGRAYNISVFSVKRNTNNKNDISRPAALLTRTRPRPIEDFEVTNISANA
ISVQWALHRIQHATVSRVRVSILYPEASAVQSTEVDRSVDRLTFGDLLPGRRYTVRLTTL
SGPGGAEYPTESLASAPLNVWTRPLPPANLTASRVTATSAHMVWDTPAPGISLEAYVINV
TTSQSTKSRYIPNGKLVSYTVRDLMPGRRYQLSVTAVQSTEQGQLHSEPAHLYIITSPRD
GTDRRWHHGGHHSRMLRNRPAPVRLPELRLLNDHSAPETPTQSSRFSELVDGRGRVSARF
GGLPSRAVTVRSQPTTPVPLKNTEAPEQVHLALQLPKNSSKDTESTPGSCSEDACQNGGT
CVPGADAHSCDCRPGFKGRHCELACEKVPRPCTRLFSETKSFPVWEGDICHHVYKKVYKV
HQDVCFKERCQSTSLRKPKQETK
Download sequence
Identical sequences A0A0R4J0N0
NP_766051.4.92730 ENSMUSP00000050832 ENSMUSP00000050832 10090.ENSMUSP00000050832 ENSMUSP00000050832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]