SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000050968 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000050968
Domain Number 1 Region: 601-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 545-602
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 489-546
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.52e-21
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 339-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.32e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 6 Region: 45-91
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.02e-19
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 7 Region: 647-699
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 8 Region: 419-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.21e-18
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 9 Region: 282-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000187
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000050968
Domain Number - Region: 211-266
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0234
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000050968   Gene: ENSMUSG00000030469   Transcript: ENSMUST00000058104
Sequence length 735
Comment pep:novel chromosome:GRCm38:7:43579610:43593235:1 gene:ENSMUSG00000030469 transcript:ENSMUST00000058104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTYLQNPEKIRERPRVETTEDMPTDMNFCQMPQQLGAEEQDGLCERLVSFDDVTVDFSQ
EEWQHLDSAQRRLYQDVMLEIYSHLLSVGKLQLDTQHQQIFVKASFLSDAASEVTKHGSI
YCSVLEKLWQEGDPAAKTDQQSRVLPVSPGAFQNQKILTIGSAWDYEETEESTLLEPHLI
STQYVPPRANSDSQSNTIKQLNDIIGSDQFFTQASSNGVCTVPHQTEKPYTESQFGNIVS
LNPPLMDHEINFQDKPVEYTGCGKVFTGETAFCQQQITNSMETSFICHTCGKTFLHKSKL
TSHSETPREETPYECPDCAKSLRGTTSLQVLRGVQTKEKPYECHVCGKSFSYTSHLKVHL
RTHTGEKPYACSDCGKAFSQKSVLTIHQRIHTGEKPYTCSDCGKMFVCASDLTKHCRFHT
GEKPYECPDCGKSFSIKSNLLAHHRIHTSEGPYKCFHCGESFRKISQLKVHHQIHTDRRS
FVCSDCGMAFSQKSVLTTHQRIHSGEKCYPCSDCGKLFLYASDLKKHCRFHTGEKPYKCH
DCGKSYSVKSHLHVHHRIHTGERPYKCDDCGKSFRRNSHLQMHQQTHTGEKPYKCSDCGK
SFRRASHLKVHHRIHTGEKPFVCSECGKAFNDRSVLSTHQRIHTGEKPYICSDCGKAMSS
KANLKEHQRIHTGEKPYVCAECGKAFSDKSSFYRHCKIHSRGKPFVRNKGEKGFLQNSQV
TSMTSYEQTQNAEKL
Download sequence
Identical sequences Q8BIV1
NP_766070.1.92730 XP_006540822.1.92730 XP_017177579.1.92730 ENSMUSP00000050968 ENSMUSP00000050968 10090.ENSMUSP00000050968 ENSMUSP00000050968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]