SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052557 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000052557
Domain Number 1 Region: 245-500
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 1.44e-45
Family Nuclear receptor ligand-binding domain 0.00000581
Further Details:      
 
Domain Number 2 Region: 120-203
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.59e-27
Family Nuclear receptor 0.0000372
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052557   Gene: ENSMUSG00000048938   Transcript: ENSMUST00000058899
Sequence length 505
Comment pep:known chromosome:GRCm38:3:102939658:102964133:-1 gene:ENSMUSG00000048938 transcript:ENSMUST00000058899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANTYVATSDGYYLAEPTQYYDILPEQFHYQLCDTDFQEPPYCQYSTAQFPPALQSPSLQ
SHFNTHGLDPQYSGGSWCGLDARESGQSTYVVVHDDEDEFPGAQRCRATCSLRWKGQDDM
LCMVCGDKASGYHYNALTCEGCKGFFRRSITKNAVYSCKNGGHCEMDMYMRRKCQECRLK
KCKAVGMLAECLLTEIQCKSKRLRKNFKHGPALYPAIQVEDEGADTKHVSSSTRSGKGVQ
DNMTLTQEEHRLLNTIVTVHQKSMIPLGETSKLLQEGSNPELSFLRLSEVSVLHIQGLMK
FTKGLPGFENLTTEDQAALQKASKTEVMFLHVAQLYGGKDSTSGSTMRPAKPSAGTLEVH
NPSADESVHSPENFLKEGYPSAPLTDITKEFIASLSYFYRRMSELHVSDTEYALLTATTV
LFSDRPCLKNKQHIENLQEPVLQLLFKFSKMYHPEDPQHFAHLIGRLTELRTLSHSHSEI
LRMWKTKDPRLVMLFSEKWDLHSFS
Download sequence
Identical sequences E9Q5A6
ENSMUSP00000052557 10090.ENSMUSP00000052557 ENSMUSP00000052557 NP_941060.2.92730 ENSMUSP00000052557

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]