SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000052661 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000052661
Domain Number 1 Region: 184-376
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2e-37
Family Reprolysin-like 0.00081
Further Details:      
 
Domain Number 2 Region: 397-473
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 1.15e-16
Family Blood coagulation inhibitor (disintegrin) 0.00051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000052661   Gene: ENSMUSG00000031554   Transcript: ENSMUST00000050300
Sequence length 771
Comment pep:known chromosome:GRCm38:8:24727093:24824059:-1 gene:ENSMUSG00000031554 transcript:ENSMUST00000050300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFLLLLLFLHLKGLQAGQNPQKTTLQTTVPEKISSPDVETDAEDHMAYLITINETPHFIH
LKKQSFITPTAVVYTYDRNDVQHSQPLSALENCNYNGYVAGFPNSIVTLTVCTGLRGIIQ
FENVSYAIEPVETLSGFVHVIYENTNKHAVIPDLGKNQSYSWFDESDYQFRSNMKKSGFT
VLRQRFIMMDIIVDKKLFDYMGSDTEVVLQKVIQIIGFVNTMLSKLKLTVLINSIEIWSK
ENRIRLSKAVDDLLVQFSIWKHEYRSQHVAYLLAFEEHPASTGALYPGNLCKLEYNAAVA
LYPKGLSLESFSVIVLQLLSIGMGLTYDTENCHCTGEVCLMTPKAIYSGGVKDFSTCTLD
DFKYLSTRQDLRCLQDLPLERKPARRPRRICGNGILEMNEQCDCGTLKNCTHRKCCDPMS
CRLKNKATCGSGECCSQDCTVKMNDVVCRKSVDECDFVEYCNGKDPYCVPNTYARNGQYC
ESGEAFCFEGRCQTADKQCMSMLGKYVRGASFACYEEFNSRGDRFGNCIHNFCAFRNSLC
GKLICTWPFKKLVLKANLSVAYAQIRDDLCVAMYKGGRIPKTTKTTYSNPADRDETFVND
GTICGPDMFCLRASCTETRFHMDSSKCDSTRDCNDHGVCNNLQHCHCDIGYNPPFCEEHK
GQFGSVDDGHKYHVEDGKSYKQQSHSNLKKNQLQLILYISLPLLVMISAVVIKQSKLSRV
CDRERSESDSSTTEDSGSNTNVTSSGGSSSTDPPITPNPERILYVFALKKH
Download sequence
Identical sequences ENSMUSP00000052661 NP_001258987.1.92730 10090.ENSMUSP00000052661 ENSMUSP00000052661 ENSMUSP00000052661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]