SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000054292 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000054292
Domain Number 1 Region: 203-392
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.28e-51
Family Reprolysin-like 0.00012
Further Details:      
 
Domain Number 2 Region: 412-487
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.58e-21
Family Blood coagulation inhibitor (disintegrin) 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000054292   Gene: ENSMUSG00000046258   Transcript: ENSMUST00000053441
Sequence length 763
Comment pep:known chromosome:GRCm38:8:55870912:55906948:-1 gene:ENSMUSG00000046258 transcript:ENSMUST00000053441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMIEALLSMRVLFLTQVFGIFLCFPGLTKAGHLHYHSSIEVVIPMKVTEKTRGMNLPNW
ISYSLKLGGQRYIIHMKIKNLFLTRHLPVFTYSDQDSLLEDYPFVQDDCYYQGYVEGDSE
SLVSLSSCFGGFHGLLEINNIVYEIMPKKFSRKFEHLVYKVDSNKTESRGSSLMQDNITC
QVELQKSGNPILKQSSFEDWWTHTKIVELVVVVDKTLYDHYGNYTVMLSDLYSVINIVDT
IYEVIGIKILLVGVEVWNKKNLIVIDDVSKSLRLYCRWKASNFLHRLKHDVSHLFIYRHL
RGLSGIGSTGGICDPKRSCAVVTFIDRTLNLRAIGVAHHLGHNLGMKHDEDICKCSYSKC
IMHMDSPPIPKFSNCSYNYFWSYTVKNTRCLMENMYTKDIFDRTRCGNGVVEDKEQCDCG
SLRNCTNDLCCMSNCTLSTGSSCAFGLCCKNCQFLPSGTLCRKRDNICDLPEWCNGTSHE
CPDDAYVEDGIPCGVSAYCYEKQCNDRNEHCRQIFGQNAKTASVHCYREINTKGDRFGHC
GLQGPTYIKCKSNDALCGRIQCDNVVQIPNMKDHSTIHFALVKNVSCWGTDYHTGTSLTD
IGDVKDGTECEQNHICINRHCVHISTLDSNCTPAFCNYRGICNNKHHCHCNFHWDPPNCM
IRGHGGSVDSGLPPKTNKKKHFFYLLLLQLIILACLLSCLLWLLFNIKGSKRKPQVQPTP
VKTKKVSKKVPSQKPSPVPSPSLPQLRMPSRSASPTSSIKSTN
Download sequence
Identical sequences G3X9B5
ENSMUSP00000054292 NP_787953.2.92730 10090.ENSMUSP00000054292 ENSMUSP00000054292 ENSMUSP00000054292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]