SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000054474 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000054474
Domain Number 1 Region: 344-688
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 3.66e-35
Family Hect, E3 ligase catalytic domain 0.013
Further Details:      
 
Domain Number 2 Region: 210-292
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.87e-28
Family PHD domain 0.001
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000054474
Domain Number - Region: 139-198
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00112
Family PHD domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000054474   Gene: ENSMUSG00000035293   Transcript: ENSMUST00000054308
Sequence length 716
Comment pep:known chromosome:GRCm38:12:51348061:51376986:1 gene:ENSMUSG00000035293 transcript:ENSMUST00000054308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNENKPDNSQSLACVFCRKNDDCPNKYGEKKTYEKWNFSVHYYCLLMSSGIWQRGKEEEG
VYGFLIEDIRKEVQRASKLKCTVCKKNGASIGCVVPTCKRSYHLPCGLQKECIFQFTDNF
ASFCWKHRPVQAITSNKYSSSLPCTICLEFVEPIPTYNILQSPCCKNAWFHRDCLQVQAI
NAGVFFFRCTLCNNTDIFQKEMLRMGIHIPEKDASWELEENAYQELLQSHDRCDIRRCHC
KKGRDYNEPNSKWEVKRCQSCGSSGTHLACSSLQSWEQNWECLDCRRITYTSDFQKAPKH
PLANSTNVTVTDCLLEESSSKLPRQSTVAQHKELLRQGSKFRRDISTILIELGFQIKKKT
KTLYINKANVWRSALEQFQSQKFNPSCSIDVVYVNGNEVGSQHLGSKQEFLSHLMHHLEN
SSVFEGSLAKNLSLNSQAVKENLYYEVGKMLAISLVHGGPSPGFFSETLFNCLAYGPENT
LPTLDDVSDIDVAQIIIKIDSATDLNILNSVISQHYNYLEVSGCLRLTTSLSDKFMLVKD
ILFYHVINRVKAPFESFKQGLKTLGVLEKIQTYPEAFYKILCHKPENLSAKNLSDLFTIH
SVADVQTLRFWNSYLKAIEDGKSATTMEDILIFATGCSSVPPTGFKPSLSVECLHVDFPV
ADKYRNHLVLPATNTYEEFQENMDFTIRDTLRLEKEERSHILPRTLNVSSNEEMLI
Download sequence
Identical sequences Q5RJY2
NP_001015099.2.92730 ENSMUSP00000054474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]