SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000057346 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000057346
Domain Number 1 Region: 14-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.4e-38
Family Dual specificity phosphatase-like 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000057346   Gene: ENSMUSG00000047205   Transcript: ENSMUST00000055931
Sequence length 188
Comment pep:known chromosome:GRCm38:11:3895240:3901296:1 gene:ENSMUSG00000047205 transcript:ENSMUST00000055931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSPWSAFPVQIPQPSIRGLSQITKSLFISNGVAANNKLLLSSNQITTVINVSVEVANTF
YEDIQYVQVPVVDAPVARLSNFFDSVADRIHSVEMQKGRTLLHCAAGVSRSAALCLAYLM
KYHAMSLVDAHTWTKSCRPIIRPNSGFWEQLIHYELQLFGKNTMQMMDSPMGRIPDIYEK
ETRLMIPL
Download sequence
Identical sequences Q8VE01
ENSMUSP00000057346 10090.ENSMUSP00000057346 NP_776106.1.92730 XP_006514936.1.92730 ENSMUSP00000057346 ENSMUSP00000057346 ENSMUSP00000105624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]