SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058007 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058007
Domain Number 1 Region: 632-782
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-18
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 2 Region: 427-599
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.49e-17
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 3 Region: 814-836,890-1027
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000000594
Family Laminin G-like module 0.034
Further Details:      
 
Domain Number 4 Region: 312-399,429-442,608-645
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000157
Family Growth factor receptor domain 0.009
Further Details:      
 
Domain Number 5 Region: 150-192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000195
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 6 Region: 112-154
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000304
Family EGF-type module 0.01
Further Details:      
 
Domain Number 7 Region: 228-267
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000781
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 8 Region: 1172-1213
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000138
Family EGF-type module 0.0092
Further Details:      
 
Domain Number 9 Region: 188-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000657
Family EGF-type module 0.007
Further Details:      
 
Domain Number 10 Region: 1056-1101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000231
Family EGF-type module 0.0076
Further Details:      
 
Domain Number 11 Region: 78-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000268
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 1092-1130
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000639
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000058007
Domain Number - Region: 262-284
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00543
Family EGF-type module 0.011
Further Details:      
 
Domain Number - Region: 807-871
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0753
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number - Region: 1135-1169
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0877
Family EGF-type module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058007   Gene: ENSMUSG00000035403   Transcript: ENSMUST00000050372
Sequence length 1282
Comment pep:known chromosome:GRCm38:2:37776249:37799103:1 gene:ENSMUSG00000035403 transcript:ENSMUST00000050372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALVGPRIWGPRRDIYPLLLLLLLLLLLLLPWVPAGLVPPETPSVCASDPCAPGTKCQAT
ESGGYTCEPSELGGCATQPCHHGALCVPQGPDPNSFRCYCVPGFQGPHCELDIDECASRP
CQHGGTCQNLADHYECHCPLGYAGVTCEAEVDECSSAPCLHGGSCLDGVGSYRCVCAPGY
AGANCQLDVDECQSQPCAHGGVCHDLVNGFRCDCADTGYEGARCEQEVLECASAPCAHNA
SCLDGFRSFRCLCWPGFSGERCEVDEDECASGPCQNGGQCLQRSDPTLYGGVQAIFPGAF
SFSHAAGFLCSCPLGFAGNDCSMDVDECASGPCLNGGSCQDLPNGFQCYCQDGYTGLTCQ
EDMDECQSEPCLHGGTCSDTVAGYICQCPEAWGGHDCSVQLTGCQGHTCPLAATCIPTFK
SGLHGYFCRCPPGTYGPFCGQNTTFSVVSGSSVWGLVPAAASLGLALRFRTTLLAGTLAT
LKDTRDSLELVLVGAVLQATLSRHGTAVLILTLPDLALNDGHWHQVEVTLHLGTLELRLW
HEGCPGQLCVASGPVATGPTASVASGPPGSYSIYLGGGVFAGCFQDVRVEGHLLLPEELK
GTVLLGCERREPCQPLPCAHGGACVDLWTHFRCDCPRPYRGATCTDEVPAATFGLGGATS
SASFLLHQLGPNLTVSFFLRTREPAGLLLQFANDSVASLTVFLSEGQIRAEGLGHPAVVL
PGRWDDGLPHLVMLSFGPDQLQDLGQRLYVGGRFYPDDTQLWGGPFRGCLQDLQLNSIHL
PFFSSPMENSSWPSELEAGQSSNLTQGCVSEDTCNPNPCFNGGTCHVTWNDFYCTCSENF
TGPTCAQQRWCPRQPCLPPATCEEVPDGFVCVAEATFREGPPAVFTGHNVSSSLSGLTLA
FRTRDSEAGLLRAVSAAGAHSNIWLAVRNGSLAGDVAGSVLPAPGPRVADGAWHRVRLAR
EFPQAAASRWLLWLDGAATPVALHGLGGDLGFLQGPGAVPLLLAENFTGCLGRVALGDFP
LPLAPPRSGTVSGAREHFVAWPGSPAVSLGCRGGPVCSPSPCLHGGACRDLFDAFACSCG
PAWEGPRCEIRADPCRSTPCVRGQCHARPDGRFECRCPPGFSGPRCRLPVLPQGCNLNST
CKDGAPCEGGPLGTNCSCQEGLAGLRCQSLDKPCEASPCLNGGTCRVASGIFECTCSAGF
SGQFCEVVKTLPLPLPFPLLEVAVPAACACLLLLLLGLLSGILAARKRRQSEGTYSPSQQ
EVAGARLEMDSVLKVPPEERLI
Download sequence
Identical sequences Q80YA8
ENSMUSP00000058007 NP_001157038.1.92730 ENSMUSP00000058007 10090.ENSMUSP00000058007 ENSMUSP00000058007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]