SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000058470 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000058470
Domain Number 1 Region: 217-259
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000148
Family EGF-type module 0.0084
Further Details:      
 
Domain Number 2 Region: 256-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000021
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 177-224
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 4 Region: 137-178
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000599
Family EGF-type module 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000058470
Domain Number - Region: 108-139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0061
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000058470   Gene: ENSMUSG00000047428   Transcript: ENSMUST00000061722
Sequence length 425
Comment pep:known chromosome:GRCm38:17:46297421:46303271:1 gene:ENSMUSG00000047428 transcript:ENSMUST00000061722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKITMRVSVPLSPRQAASQPVPSHRCLHVWPFIRPSLLRPELTMPSGCRCLNLVCLLCIL
GATSQPARADDCSSHCDLAHGCCAPDGSCRCDPGWEGLHCERCVRMPGCQHGTCHQPWQC
ICHSGWAGKFCDKDEHICTSQSPCQNGGQCVYDGGGEYHCVCLPGFHGRGCERKAGPCEQ
AGFPCRNGGQCQDNQGFALNFTCRCLAGFMGAHCEVNVDDCLMRPCANGATCIDGINRFS
CLCPEGFAGRFCTINLDDCASRPCQRGARCRDRVHDFDCLCPSGYGGKTCELVLPAPEPA
SVGTPQMPTSAVVVPATGPAPHSAGAGLLRISVKEVVRRQESGLGESSLVALVVFGSLTA
ALVLATVLLTLRAWRRGICPTGPCCYPAPHYAPARQDQECQVSMLPAGFPLSPDLPPEPG
KTTAL
Download sequence
Identical sequences MmR266 ENSMUSP00000058470 10090.ENSMUSP00000058470 ENSMUSP00000058470 ENSMUSP00000058470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]