SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000059982 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000059982
Domain Number 1 Region: 9-173
Classification Level Classification E-value
Superfamily RUN domain-like 6.02e-50
Family RUN domain 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000059982   Gene: ENSMUSG00000020070   Transcript: ENSMUST00000062600
Sequence length 217
Comment pep:known chromosome:GRCm38:10:62980293:63002219:1 gene:ENSMUSG00000020070 transcript:ENSMUST00000062600 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MATKDPTAVERANLLNMAKLSIKGLIESALSFGRTLDSDYPPLQQFFVVMEHCLKHGLKG
RKSFLSYNKTIWGPLELVEKLYPEAEEIGASVRDLPGLKTPLGRARAWLRLALMQKKMAD
YLRCLIIQRELLSEFYEYHALMMEEEGAVIVGLLVGLNVIDANLCVKGEDLDSQVGVIDF
SMYLKNEEEIGNKERNVQIAAILDQKNYVEELNRQLN
Download sequence
Identical sequences D6RET4
ENSMUSP00000059982

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]