SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060307 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060307
Domain Number 1 Region: 88-277
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.16e-24
Family Pentraxin (pentaxin) 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000060307
Domain Number - Region: 591-855
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0403
Family Rhodopsin-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060307   Gene: ENSMUSG00000044017   Transcript: ENSMUST00000056617
Sequence length 903
Comment pep:known chromosome:GRCm38:5:129096750:129204599:1 gene:ENSMUSG00000044017 transcript:ENSMUST00000056617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDLPAFPCSWVWLLWSFCSVQVCSTQPRAQEHPGFAVLASASHYWPLENVDGILELQDT
TGALRTLNLTVPLSHNATFVFTNDSAYSNLSATVDIMEGKVNKGIYLKEEKGVTFLYYGT
YKSSCISNPAQCGPEGVTFSFFWKTQGDQTRPAPYAYGGQVVSDGFKVCSSGGKGSVELY
TRDNSMTWKATFNPPGPYWTHVLFTWKSKEGLKVYVNGTLSTSDPSGKVSHTYGDPHVNL
VIGSEQDQTKRYENGAFDEFIIWERALTPDEIKMYFTAAIGKHALLSSTPPAMPTAHTVI
PTDAYHPIITNLTEERKRFQRPGTVLRYLQNVSLRLPNKSLSEETALNLTETFLRTVGEV
LLLPSWTHESEDNAMTLGLVDTIDTVMGHISSNLQSREPHVTLTGSSSTAEFTVAKVLPP
ALSAPHYRFPAHGHSYIEIPREALHSQAWTTIVGLLYHTMHYYLKNIHPTSTEIPEAVNC
RDCLLSVASHLISLEVSPPPTLSQNLSGSPLITVHLRHKLTQKQYSDATNESNRLFLYCA
FLNFSSGEGVWSSQGCALTEGNLTYSVCHCTHLTNFAILMQVVPLKLTHGHQVALSSISY
VGCSLSVLCLAATLVTFAVLSSVSTIRNQRYHIHANLSFAVLVAQVLLLISFSMEPGTVP
CQVLAVLLHYFFLTAFAWMLVEGLHLYSMVIKVFGSEDSKHLYYYGIGWGCPLLICIISI
SSSMDSYGTSDSCWLALGSGAIWAFVGPALLVIVVNIVILVAVTRVISHISTDSYKIHGD
PSAFKLTAKAVAVLLPILGTSWVFGVLAVSDRALVFQYMFAILNSLQGLFIFLFHCLLNS
EVRAAFKHKTKVWSLTSSSARTANTKPFSSDTVNGTRPGTASTKLSPWDKSSHSAHRVDL
SAV
Download sequence
Identical sequences Q80T32
NP_001074811.1.92730 10090.ENSMUSP00000060307 ENSMUSP00000060307 ENSMUSP00000060307 ENSMUSP00000060307

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]