SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000060769 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000060769
Domain Number 1 Region: 461-675
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-28
Family Laminin G-like module 0.011
Further Details:      
 
Domain Number 2 Region: 687-888
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.5e-26
Family Laminin G-like module 0.021
Further Details:      
 
Domain Number 3 Region: 910-1110
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.52e-24
Family Laminin G-like module 0.01
Further Details:      
 
Domain Number 4 Region: 147-189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000554
Family EGF-type module 0.0041
Further Details:      
 
Domain Number 5 Region: 1296-1336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000101
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 6 Region: 302-348
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000419
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 7 Region: 1140-1180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000893
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 8 Region: 185-227
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000762
Family EGF-type module 0.0039
Further Details:      
 
Domain Number 9 Region: 223-265
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000193
Family EGF-type module 0.0064
Further Details:      
 
Domain Number 10 Region: 261-299
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000097
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 11 Region: 1210-1250
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000062
Family EGF-type module 0.033
Further Details:      
 
Domain Number 12 Region: 71-113
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000921
Family EGF-type module 0.017
Further Details:      
 
Domain Number 13 Region: 1175-1215
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000113
Family EGF-type module 0.012
Further Details:      
 
Domain Number 14 Region: 110-152
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000001
Family EGF-type module 0.018
Further Details:      
 
Domain Number 15 Region: 1263-1300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000133
Family EGF-type module 0.019
Further Details:      
 
Domain Number 16 Region: 377-480
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000314
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000060769
Domain Number - Region: 884-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0112
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 924-957
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0652
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000060769   Gene: ENSMUSG00000063681   Transcript: ENSMUST00000059825
Sequence length 1405
Comment pep:known chromosome:GRCm38:1:139197056:139377041:-1 gene:ENSMUSG00000063681 transcript:ENSMUST00000059825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLKRTAYLLFLYLSSSLLICIKNSFCNKNNTRCLSGPCQNNSTCKHFPQDNNCCLDTAN
NLDKDCEDLKDPCFSSPCQGIATCVKIPGEGNFLCQCPPGYSGLNCETATNSCGGNLCQH
GGTCRKDPEHPVCICPPGYAGRFCETDHNECASSPCHNGAMCQDGINGYSCFCVPGYQGR
HCDLEVDECVSDPCKNEAVCLNEIGRYTCVCPQEFSGVNCELEIDECRSQPCLHGATCQD
APGGYSCDCAPGFLGEHCELSVNECESQPCLHGGLCVDGRNSYHCDCTGSGFTGMHCESL
IPLCWSKPCHNDATCEDTVDSYICHCRPGYTGALCETDINECSSNPCQFWGECVELSSEG
LYGNTAGLPSSFSYVGASGYVCICQPGFTGIHCEEDVDECLLHPCLNGGTCENLPGNYAC
HCPFDDTSRTFYGGENCSEILLGCTHHQCLNNGKCIPHFQNGQHGFTCQCLSGYAGPLCE
TVTTLSFGSNGFLWVTSGSHTGIGPECNISLRFHTVQPNALLLIRGNKDVSMKLELLNGC
VHLSIEVWNQLKVLLSISHNTSDGEWHFVEVTIAETLTLALVGGSCKEKCTTKSSVPVEN
HQSICALQDSFLGGLPMGTANNSVSVLNIYNVPSTPSFVGCLQDIRFDLNHITLENVSSG
LSSNVKAGCLGKDWCESQPCQNRGRCINLWQGYQCECDRPYTGSNCLKEYVAGRFGQDDS
TGYAAFSVNDNYGQNFSLSMFVRTRQPLGLLLALENSTYQYVSVWLEHGSLALQTPGSPK
FMVNFFLSDGNVHLISLRIKPNEIELYQSSQNLGFISVPTWTIRRGDVIFIGGLPDREKT
EVYGGFFKGCVQDVRLNSQTLEFFPNSTNNAYDDPILVNVTQGCPGDNTCKSNPCHNGGV
CHSLWDDFSCSCPTNTAGRACEQVQWCQLSPCPPTAECQLLPQGFECIANAVFSGLSREI
LFRSNGNITRELTNITFAFRTHDTNVMILHAEKEPEFLNISIQDARLFFQLRSGNSFYTL
HLMGSQLVNDGTWHQVTFSMIDPVAQTSRWQMEVNDQTPFVISEVATGSLNFLKDNTDIY
VGDQSVDNPKGLQGCLSTIEIGGIYLSYFENLHGFPGKPQEEQFLKVSTNMVLTGCLPSN
ACHSSPCLHGGNCEDSYSSYRCACLSGWSGTHCEINIDECFSSPCIHGNCSDGVAAYHCR
CEPGYTGVNCEVDVDNCKSHQCANGATCVPEAHGYSCLCFGNFTGRFCRHSRLPSTVCGN
EKRNFTCYNGGSCSMFQEDWQCMCWPGFTGEWCEEDINECASDPCINGGLCRDLVNRFLC
ICDVAFAGERCELDLADDRLLGIFTAVGSGTLALFFILLLAGVASLIASNKRATQGTYSP
SGQEKAGPRVEMWIRMPPPALERLI
Download sequence
Identical sequences Q8VHS2
ENSMUSP00000060769 NP_573502.2.92730 10090.ENSMUSP00000060769 ENSMUSP00000060769 ENSMUSP00000060769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]