SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000067884 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000067884
Domain Number 1 Region: 655-746
Classification Level Classification E-value
Superfamily Small-conductance potassium channel 4.84e-40
Family Small-conductance potassium channel 0.0000026
Further Details:      
 
Domain Number 2 Region: 524-695
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-26
Family Voltage-gated potassium channels 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000067884   Gene: ENSMUSG00000054477   Transcript: ENSMUST00000066890
Sequence length 839
Comment pep:known chromosome:GRCm38:18:45269005:45686024:1 gene:ENSMUSG00000054477 transcript:ENSMUST00000066890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPIVLVRPTNRTRRLDSTGAGMGPSSHQQQESPLPTITHCAGCTTAWSPCSFNSSDMETP
LQFQRGFFPEQPPPPPRSSHLHCQQQQQSQDKPCAPFAPLPHPHHHPHLAHQQPGSGGSS
PCLRCNSCASSGAPAAGAGAGDNLSLLLRTSSPGGAFRTRTSSPLSGSSCCCCCSSRRGS
QLNVSELTPSSHASALRQQYAQQPASASQYHQCHSLQPATSPTGSLGSLGSGPPLSHHHH
HPHPAHHQHHQPQARRESNPFTEIAMSSCRYNGGVMRPLSNLSSSRRNLQEMDSEAQPLQ
PPASVVGGGGGASSPSAAAAASSSAPEIVVSKPEHNNSNNLALYGTGGGGSTGGGGGGSG
HGSSSGTKSSKKKNQNIGYKLGHRRALFEKRKRLSDYALIFGMFGIVVMVIETELSWGAY
DKASLYSLALKCLISLSTIILLGLIIVYHAREIQLFMVDNGADDWRIAMTYERIFFICLE
ILVCAIHPIPGNYTFTWTARLAFSYAPSTTTADVDIILSIPMFLRLYLIARVMLLHSKLF
TDASSRSIGALNKINFNTRFVMKTLMTICPGTVLLVFSISLWIIAAWTVRACERYHDQQD
VTSNFLGAMWLISITFLSIGYGDMVPNTYCGKGVCLLTGIMGAGCTALVVAVVARKLELT
KAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIH
QLRSVKMEQRKLNDQANTLVDLAKTQNIMYDMISDLNERSEDFEKRIVTLETKLETLIGS
IHALPGLISQTIRQQQRDFIETQMENYDKHVSYNAERSRSSSRRRRSSSTAPPTSSESS
Download sequence
Identical sequences P58390
ENSMUSP00000067884 ENSMUSP00000139350 ENSMUSP00000067884 ENSMUSP00000126285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]