SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069087 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069087
Domain Number 1 Region: 350-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000014
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 2 Region: 987-1037
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000614
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 3 Region: 939-989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000126
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 4 Region: 525-564
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 5 Region: 784-825
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000165
Family Laminin-type module 0.0076
Further Details:      
 
Domain Number 6 Region: 832-880
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family Laminin-type module 0.015
Further Details:      
 
Domain Number 7 Region: 878-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Laminin-type module 0.0085
Further Details:      
 
Domain Number 8 Region: 473-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000026
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 9 Region: 286-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000949
Family Laminin-type module 0.032
Further Details:      
 
Domain Number 10 Region: 438-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000167
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 11 Region: 1144-1192
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000389
Family Laminin-type module 0.019
Further Details:      
 
Domain Number 12 Region: 1039-1093
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.0024
Further Details:      
 
Domain Number 13 Region: 1096-1139
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000103
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000069087
Domain Number - Region: 1581-1782
Classification Level Classification E-value
Superfamily Tropomyosin 0.00915
Family Tropomyosin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069087   Gene: ENSMUSG00000052911   Transcript: ENSMUST00000065014
Sequence length 1799
Comment pep:known chromosome:GRCm38:9:108479862:108490530:1 gene:ENSMUSG00000052911 transcript:ENSMUST00000065014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWASGEPGRGRQGQPLPWELRLGLLLSVLAATLAQAPSLDVPGCSRGSCYPATGDLLVG
RADRLTASSTCGLHSPQPYCIVSHLQDEKKCFLCDSRRPFSARDNPNSHRIQNVVTSFAP
QRRTAWWQSENGVPMVTIQLDLEAEFHFTHLIMTFKTFRPAAMLVERSADFGRTWHVYRY
FSYDCGADFPGIPLAPPRRWDDVVCESRYSEIEPSTEGEVIYRVLDPAIPIPDPYSSRIQ
NLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYELVIRGNCFCYGHASQCAPAPG
APAHAEGMVHGACICKHNTRGLNCEQCQDFYQDLPWHPAEDGHTHACRKCECNGHTHSCH
FDMAVYLASGNVSGGVCDGCQHNTAGRHCEFCRPFFYRDPTKDMRDPAVCRPCDCDPMGS
QDGGRCDSHDDPVLGLVSGQCRCKEHVVGTRCQQCRDGFFGLSASDPRGCQRCQCNSRGT
VPGSSPCDSSSGTCFCKRLVTGHGCDRCLPGHWGLSHDLLGCRPCDCDVGGALDPQCDEA
TGQCRCRQHMIGRRCEQVQPGYFRPFLDHLTWEAEAAQGQGLEVVERLVTNRETPSWTGP
GFVRLREGQEVEFLVTSLPRAMDYDLLLRWEPQVPEQWAELELMVQRPGPVSAHSPCGHV
LPKDDRIQGMLHPNTRFLVFPRPVCLEPGISYKLKLKLIGTGGRAQPETSYSGLLIDSLV
LQPHVLVLEMFSGGDAAALERRTTFERYRCHEEGLMPSKAPLSETCAPLLISVSALIYNG
ALPCQCDPQGSLSSECSPHGGQCRCKPGVVGRRCDVCATGYYGFGPAGCQACQCSPDGAL
SALCEGTSGQCPCRPGAFGLRCDHCQRGQWGFPNCRPCVCNGRADECDTHTGACLGCRDY
TGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQRHFATSCHRDGYSQQIVCQCREG
YTGLRCEACAPGHFGDPSKPGGRCQLCECSGNIDPMDPDACDPHTGQCLRCLHNTEGPHC
GYCKPGFHGQAARQSCHRCTCNLLGTDPRRCPSTDLCHCDPSTGQCPCLPHVQGLNCDHC
APNFWNFTSGRGCQPCACHPSRARGPTCNEFTGQCHCHAGFGGRTCSECQELYWGDPGLQ
CRACDCDPRGIDKPQCHRSTGHCSCRPGVSGVRCDQCARGFSGVFPACHPCHACFGDWDR
VVQDLAARTRRLEQWAQELQQTGVLGAFESSFLNMQGKLGMVQAIMSARNASAASTAKLV
EATEGLRHEIGKTTERLTQLEAELTAVQDENFNANHALSGLERDGLALNLTLRQLDQHLE
ILKHSNFLGAYDSIRHAHSQSTEAERRANASTFAVPSPVSNSADTRRRTEVLMGAQKENF
NRQHLANQQALGRLSAHAHTLSLTGINELVCGAPGDAPCATSPCGGAGCRDEDGQPRCGG
LGCSGAAATADLALGRARHTQAELQRALVEGGGILSRVSETRRQAEEAQQRAQAALDKAN
ASRGQVEQANQELRELIQNVKDFLSQEGADPDSIEMVATRVLDISIPASPEQIQRLASEI
AERVRSLADVDTILAHTMGDVRRAEQLLQDAHRARSRAEGERQKAETVQAALEEAQRAQG
AAQGAIWGAVVDTQNTEQTLQRVQERMAGAEKSLNSAGERARQLDALLEALKLKRAGNSL
AASTAEETAGSAQSRAREAEKQLREQVGDQYQTVRALAERKAEGVLAAQARAEQLRDEAR
DLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGLEARMRSVLQAINLQVQIYNTCQ
Download sequence
Identical sequences Q61292
10090.ENSMUSP00000069087 ENSMUSP00000069087 ENSMUSP00000069087 NP_032509.2.92730 XP_006511711.1.92730 ENSMUSP00000069087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]