SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000069466 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000069466
Domain Number 1 Region: 242-440
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.36e-48
Family Reprolysin-like 0.0002
Further Details:      
 
Domain Number 2 Region: 457-533
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 4.32e-19
Family Blood coagulation inhibitor (disintegrin) 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000069466
Domain Number - Region: 688-715
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family Integrin beta EGF-like domains 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000069466   Gene: ENSMUSG00000020926   Transcript: ENSMUST00000068150
Sequence length 778
Comment pep:known chromosome:GRCm38:11:102761439:102780262:1 gene:ENSMUSG00000020926 transcript:ENSMUST00000068150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRLRRWAIAALLLLPLLPPPGLGALGPRGALHWRSSAHVGSPESPEGSEVTEPSRLVRQ
SSGGEVRKPQLDTRVRQDPPRGTPVHLAQVSFVIPAFDSNFTLDLELNHHLLSSQYVERH
FSREGTRQHSTGAGDHCYYHGKLRGNPQSFAALSTCQGLHGVFSDGNLTYIVEPKEIAGP
WGPPQGPLPHLIYRTPLLPAPLGCREPGCLFAVPAQSALPNWPKLRRKRQVRRGHPTVHS
ETKYVELIVINDHQLFEQMRQSVVLTSNFAKSVVNLADVIYKEQLNTRIVLVAMETWADG
DKIQVQDDLLETLARLMVYRREGLPEPSDATHLFSGRTFQSTSSGAAYVGGICSLSRGGG
VNEYGNMGAMAVTLAQTLGQNLGMMWNKHRSSAGDCKCPDIWLGCIMEDTGFYLPRKFSR
CSIDEYNQFLQEGGGSCLFNKPLKLLDPPECGNGFVEAGEECDCGSVQECSRAGGNCCKK
CTLTHDAMCSDGLCCRRCKYEPRGVSCREAVNECDIAETCTGDSSQCPPNLHKLDGYYCD
HEQGRCYGGRCKTRDRQCQALWGHAAADRFCYEKLNVEGTERGNCGRKGSGWVQCSKQDV
LCGFLLCVNISGAPRLGDLGGDISSVTFYHQGKELDCRGGHVQLADGSDLSYVEDGTACG
PNMLCLDHRCLPASAFNFSTCPGSGERRICSHHGVCSNEGKCICQPDWTGKDCSIHNPLP
TSPPTGETERYKGPSGTNIIIGSIAGAVLVAAIVLGGTGWGFKNIRRGRYDPTQQGAV
Download sequence
Identical sequences Q7TQG7
10090.ENSMUSP00000069466 NP_001104248.1.92730 ENSMUSP00000069466 ENSMUSP00000069466 ENSMUSP00000099370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]