SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000070239 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000070239
Domain Number 1 Region: 2215-2721
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 1.04e-99
Family Acetylcholinesterase-like 0.0000418
Further Details:      
 
Domain Number 2 Region: 981-1079
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.24e-20
Family Thyroglobulin type-1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 721-782,897-927
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.5e-19
Family Thyroglobulin type-1 domain 0.005
Further Details:      
 
Domain Number 4 Region: 92-166
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.11e-18
Family Thyroglobulin type-1 domain 0.002
Further Details:      
 
Domain Number 5 Region: 297-361
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.53e-18
Family Thyroglobulin type-1 domain 0.0011
Further Details:      
 
Domain Number 6 Region: 25-93
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.62e-18
Family Thyroglobulin type-1 domain 0.002
Further Details:      
 
Domain Number 7 Region: 1135-1215
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 7.59e-16
Family Thyroglobulin type-1 domain 0.002
Further Details:      
 
Domain Number 8 Region: 611-663
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000000000000288
Family Thyroglobulin type-1 domain 0.0014
Further Details:      
 
Domain Number 9 Region: 660-730
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000000000693
Family Thyroglobulin type-1 domain 0.0013
Further Details:      
 
Domain Number 10 Region: 164-196,231-249
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.0000000392
Family Thyroglobulin type-1 domain 0.0064
Further Details:      
 
Domain Number 11 Region: 1511-1558
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.000000523
Family Thyroglobulin type-1 domain 0.0064
Further Details:      
 
Domain Number 12 Region: 1073-1137
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 0.00000549
Family Thyroglobulin type-1 domain 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000070239
Domain Number - Region: 1441-1492
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00199
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000070239   Gene: ENSMUSG00000053469   Transcript: ENSMUST00000065916
Sequence length 2766
Comment pep:known chromosome:GRCm38:15:66670753:66850721:1 gene:ENSMUSG00000053469 transcript:ENSMUST00000065916 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTALVLWVSTLLSSVCLVAANIFEYQVDAQPLRPCELQREKAFLKQAEYVPQCSEDGSFQ
TVQCQNDGQSCWCVDSDGREVPGSRQLGRPTVCLSFCQLHKQRILLGSYINSTDALYLPQ
CQDSGNYAPVQCDLQRVQCWCVDTEGMEVYGTRQQGRPTRCPRSCEIRNRRLLHGVGDRS
PPQCTADGEFMPVQCKFVNTTDMMIFDLIHNYNRFPDAFVTFSSFRGRFPEVSGYCYCAD
SQGRELAETGLELLLDEIYDTIFAGLDQASTFTQSTMYRILQRRFLAIQLVISGRFRCPT
KCEVEQFAATRFGHSYIPRCHRDGHYQTVQCQTEGMCWCVDAQGREVPGTRQQGQPPSCA
ADQSCALERQQALSRFYFETPDYFSPQDLLSSEDRLAPVSGVRSDTSCPPRIKELFVDSG
LLRSIAVEHYQRLSESRSLLREAIRAVFPSRELAGLALQFTTNPKRLQQNLFGGTFLANA
AQFNLSGALGTRSTFNFSQFFQQFGLPGFLNRDRVTTLAKLLPVRLDSSSTPETLRVSEK
TVAMNKRVVGNFGFKVNLQENQDALKFLVSLLELPEFLVFLQRAVSVPEDIARDLGDVME
MVFSAQACKQMPGKFFVPSCTAGGSYEDIQCYAGECWCVDSRGKELDGSRVRGGRPRCPT
KCEKQRAQMQSLASAQPAGSSFFVPTCTREGYFLPVQCFNSECYCVDTEGQVIPGTQSTV
GEAKQCPSVCQLQAEQAFLGVVGVLLSNSSMVPSISNVYIPQCSASGQWRHVQCDGPHEQ
VFEWYERWKTQNGDGQELTPAALLMKIVSYREVASRNFSLFLQSLYDAGQQRIFPVLAQY
PSLQDVPQVVLEGATTPPGENIFLDPYIFWQILNGQLSQYPGPYSDFNMPLEHFNLRSCW
CVDEAGQKLDGTQTKPGEIPACPGPCEEVKLRVLKFIKETEEIVSASNASSFPLGESFLV
AKGIQLTSEELDLPPQFPSRDAFSEKFLRGGEYAIRLAAQSTLTFYQSLRASLGKSDGAA
SLLWSGPYMPQCNMIGGWEPVQCHAGTGQCWCVDGRGEFIPGSLMSRSSQMPQCPTNCEL
SRASGLISAWKQAGPQRNPGPGDLFIPVCLQTGEYVRKQTSGTGTWCVDPASGEGMPVNT
NGSAQCPGLCDVLKSRALSRKVGLGYSPVCEALDGAFSPVQCDLAQGSCWCVLGSGEEVP
GTRVVGTQPACESPQCPLPFSGSDVADGVIFCETASSSGVTTVQQCQLLCRQGLRSAFSP
GPLICSLESQHWVTLPPPRACQRPQLWQTMQTQAHFQLLLPPGKMCSVDYSGLLQAFQVF
ILDELIARGFCQIQVKTFGTLVSSTVCDNSSIQVGCLTAERLGVNVTWKLQLEDISVGSL
PDLYSIERAVTGQDLLGRFADLIQSGRFQLHLDSKTFSADTTLYFLNGDSFVTSPRTQLG
CMEGFYRVPTTRQDALGCVKCPEGSFSQDGRCTPCPAGTYQEQAGSSACIPCPRGRTTIT
TGAFSKTHCVTDCQKNEAGLQCDQNGQYQASQKNRDSGEVFCVDSEGRKLQWLQTEAGLS
ESQCLMIRKFDKAPESKVIFDANSPVIVKSSVPSADSPLVQCLTDCANDEACSFLTVSTM
ESEVSCDFYSWTRDNFACVTSDQEQDAMGSLKATSFGSLRCQVKVRNSGKDSLAVYVKKG
YESTAAGQKSFEPTGFQNVLSGLYSPVVFSASGANLTDTHTYCLLACDNDSCCDGFIITQ
VKGGPTICGLLSSPDILLCHINDWRDTSATQANATCAGVTYDQGSRQMTLSLGGQEFLQG
LALLEGTQDSFTSFQQVYLWKDSDMGSRPESMGCERGMVPRSDFPGDMATELFSPVDITQ
VIVNTSHSLPSQQYWLFTHLFSAEQANLWCLSRCAQEPIFCQLADITKSSSLYFTCFLYP
EAQVCDNVMESNAKNCSQILPHQPTALFRRKVVLNDRVKNFYTRLPFQKLTGISIRDKVP
MSGKLISNGFFECERLCDRDPCCTGFGFLNVSQLQGGEVTCLTLNSMGIQTCNEESGATW
RILDCGSEDTEVHTYPFGWYQKPAVWSDTPSFCPSAALQSLTEEKVTSDSWQTLALSSVI
VDPSIKHFDVAHISTAATSNFSMAQDFCLQQCSRHQDCLVTTLQIQPGVVRCVFYPDIQN
CIHSLRSHTCWLLLHEEATYIYRKSGIPLVQSDVTSTPSVRIDSFGQLQGGSQVIKVGTA
WKQVYRFLGVPYAAPPLADNRFRAPEVLNWTGSWDATKPRASCWQPGTRTPTPPQINEDC
LYLNVFVPENLVSNASVLVFFHNTMEMEGSGGQLTIDGSILAAVGNFIVVTANYRLGVFG
FLSSGSDEVAGNWGLLDQVAALTWVQSHIGAFGGDPQRVTLAADRSGADVASIHLLISRP
TRLQLFRKALLMGGSALSPAAIISPERAQQQAAALAKEVGCPTSSIQEVVSCLRQKPANI
LNDAQTKLLAVSGPFHYWGPVVDGQYLRELPSRRLKRPLPVKVDLLIGGSQDDGLINRAK
AVKQFEESQGRTNSKTAFYQALQNSLGGEDSDARILAAAVWYYSLEHSTDDYASFSRALE
NATRDYFIICPMVNMASLWARRTRGNVFMYHVPESYGHGSLELLADVQYAFGLPFYSAYQ
GQFSTEEQSLSLKVMQYFSNFIRSGNPNYPHEFSRKAAEFATPWPDFIPGAGGESYKELS
AQLPNRQGLKQADCSFWSKYIQTLKDADGAKDAQLTKSEEEDLEVGPGLEEDLSGSLEPV
PKSYSK
Download sequence
Identical sequences O08710
ENSMUSP00000070239 ENSMUSP00000070239 ENSMUSP00000070239 10090.ENSMUSP00000070239 NP_033401.2.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]