SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000071695 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000071695
Domain Number 1 Region: 43-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 9.16e-38
Family SCAN domain 0.0000675
Further Details:      
 
Domain Number 2 Region: 607-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 3 Region: 551-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.56e-23
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 347-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.41e-20
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 649-701
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.84e-19
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 445-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000187
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 8 Region: 400-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000661
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000071695   Gene: ENSMUSG00000063488   Transcript: ENSMUST00000063980
Sequence length 718
Comment pep:known chromosome:GRCm38:9:122888471:122896124:1 gene:ENSMUSG00000063488 transcript:ENSMUST00000063980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMEGRGTLDIIPRTAMYQKQEGNLTVKQEPGSQTWGQKNYLPVCEIFRLHFRQLCYHEM
SGPQQALSRLRELCHWWLMPEVHTKEQILELLVLEQFLSILPRELQTWVQLHHPETGEEA
VAMVEDFQRHLSESGEVSPPVQEQDVHLKKMGALSAAEQSPTSTSNQGLAPGALLDPPCD
PGAGHDPAFPKVGNPRAQAVATVLRMARPQETAVNKDYKQEKWSVLCETEVVRDEHGLAS
LGKNRIGSSEFSPKQDISKGSHSLDTSSEGLFGVALVERASGDICKDPLAQREEHPSDEE
GSGLESDFLEKEDKNSTEDRNEECKDVGVHPEMPSSPVEHQGEAKRQKSYQCDECGKVFS
QSSRFLGHQRIHVGERPFECNKCGKTFQQISQLVVHLRIHTQEKPYECCESGKTYCHSSH
LIQHQRLRNGDKPYKGNECVRASIQSSQLLVHKRTHTGEKPDESGEAFIWNKSLIQHQVL
HISKKLYECNECGKAFYTNRNLIDHQRIHTGEKPYECIECGKSFSRSKCLTRHQSLHTGE
KTYKCSECGKAFLQNSQLIDHKRVHTGEKPFECSECGKKFSLGKCLIRHQRLHTGEKPYK
CSECGKSFNQNSHLIIHQRIHTGEKPYGCNECGKVFSYSSSLMVHQRTHTGEKPYKCKDC
MKAFGDSSQLIVHQRVHTGEKPYECAECGKAFSQRSTFNHHQRIHNVAKPSSRLQAVS
Download sequence
Identical sequences E9PVW1
ENSMUSP00000071695 ENSMUSP00000071695 ENSMUSP00000071695 10090.ENSMUSP00000071695 NP_001170976.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]