SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000072084 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000072084
Domain Number 1 Region: 279-438
Classification Level Classification E-value
Superfamily SIS domain 0.0000000000528
Family mono-SIS domain 0.011
Further Details:      
 
Domain Number 2 Region: 29-278
Classification Level Classification E-value
Superfamily SIS domain 0.0000000169
Family mono-SIS domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000072084   Gene: ENSMUSG00000059434   Transcript: ENSMUST00000072228
Sequence length 587
Comment pep:known chromosome:GRCm38:5:31297581:31327300:1 gene:ENSMUSG00000059434 transcript:ENSMUST00000072228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTKRYQHVIETPEPGEWELSGYEAAVPITEKSNPLTRNLDKADAEKIVQLLGQCDAEI
FQEEGQIMPTYQRLYSESVLTTMLQVAGKVQEVLKEPDGGLVVLSGGGTSGRMAFLMSVS
FNQLMKGLGQKPLYTYLIAGGDRSVVASRERTEDSALHGIEELKKVAAGKKRVVVIGISV
GLSAPFVAGQMDYCMDNTAVFLPVLVGFNPVSMARNDPIEDWRSTFRQVAERMQKMQEKQ
EAFVLNPAIGPEGLSGSSRMKGGSATKILLETLLLAAHKTVDQGVVSSQRCLLEILRTFE
RAHQVTYSQSSKIATLTKQVGISLEKKGHVHLVGWQTLGIIAIMDGVECIHTFGADFRDI
RGFLIGDHNDMFNQKDELSNQGPQFTFSQDDFLTSVLPSLTEIDTVVFIFTLDDNLAEVQ
ALAERVREKSWNIQALVHSTVGQSLPAPLKKLFPSLISITWPLLFFDYEGSYVQKFQREL
STKWVLNTRFSGQSKARCIESLLQVIHFPQPLSNDVRAAPISCHVQVAHEKEKVIPTALL
SLLLRCSITEAKERLAAASSVCEVVRSALSGPGQKRSIQAFGDPVVP
Download sequence
Identical sequences Q91X44
ENSMUSP00000072084 ENSMUSP00000072084 10090.ENSMUSP00000072084 NP_659158.1.92730 ENSMUSP00000072084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]