SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000074847 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000074847
Domain Number 1 Region: 568-678
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-24
Family Spermadhesin, CUB domain 0.00097
Further Details:      
 
Domain Number 2 Region: 386-507
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.03e-17
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 3 Region: 685-750
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000127
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 4 Region: 221-328
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000000379
Family Spermadhesin, CUB domain 0.0037
Further Details:      
 
Domain Number 5 Region: 812-871
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000695
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 6 Region: 744-806
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000001
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 7 Region: 332-393
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000126
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 8 Region: 507-571
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000823
Family Complement control module/SCR domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000074847   Gene: ENSMUSG00000058153   Transcript: ENSMUST00000075387
Sequence length 962
Comment pep:known chromosome:GRCm38:5:112419151:112577198:-1 gene:ENSMUSG00000058153 transcript:ENSMUST00000075387 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVARPQAAGPDRISLFLVAFLLGSPAAAQAEDGGPEGEMHPSTAYLLPSASLESSLEEG
VTSAAPGLLPSQEALEAMEESLPPALPDEASVQHTPALRKGLPSLKQLNSARRQLRPLAT
PTTLQRLGSPASATTKLREPEDPEQPTAPAPLQIAPFTALATTLPHSPQPAQAPDDSSPG
SPLDKGDNELTGSASEESQETTTSTIVTTTIITTEQAPALCGVSFSDPEGYIDSSDFPPQ
PYSSFLECTYNVTVYTGYGVELQVKSVNLSEGELLSIRGVDGPTLTVLANQTLLVEGQVI
RSPTNTISVYFRTFQDDGLGTFQLHYQAFMLSCPFPRRPDAGEVTVMDLHSGGVAHFHCH
LGYELQGAKTLTCINASKPHWSSQEPVCSAPCGGAVHNATIGRVLSPSFPGTANGSQLCV
WTIEAPEGQKLHLHLERLLLHEKDRMIVYSGRTNTSALLYDSLRTESVPFEGLLSEGSSI
RIEFTSDQGQAASAFNIRFEAFEKGHCYEPYIQNGNFTTSDPTYNIGTIVEFTCDPGHSL
EQGPAVIECVNVRDPYWNDTEPLCRAMCGGELSAVAGVVLSPNWPEPYAEGEDCVWKIHV
GEEKRIFLDIQFLNLSNSDILTIYDGDEVVPHVLGQYFGHSSPQKLYSSTPDLTIQFHSD
PAGLIFGKGQGFIMNYIEVSRNDSCSDLPEIQNGWKTTSHTELVRGARITYQCDPGYDIV
GSDTLTCQWDLSWSSDPPFCEKIMYCTDPGEVEHSTRLISDPVLLVGTTIQYTCSPGFVL
EGSSLLTCYSRETGTPIWTSRLPHCVSEESLACDNPGLPENGYQILYKRLYLPGESLTFM
CYEGFELMGEVTIRCILGQPSHWSGPLPICKVNQDSFEHALEEAAAESSLEGGNMALAIF
IPVLLISLLLGGAYIYVTRCRQYSSLRLPLMYSHPYSQITVETEFDNPIYETGETREYEV
SI
Download sequence
Identical sequences A0A0R4J0Y4
ENSMUSP00000074847 10090.ENSMUSP00000074847 NP_064366.2.92730 ENSMUSP00000074847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]