SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000075562 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000075562
Domain Number 1 Region: 572-622
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000396
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 609-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000167
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000837
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000079
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000075562   Gene: ENSMUSG00000040478   Transcript: ENSMUST00000076206
Sequence length 706
Comment pep:known chromosome:GRCm38:4:21677481:21685783:-1 gene:ENSMUSG00000040478 transcript:ENSMUST00000076206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGTSRTSATSVNADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTTATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSGGGGRAFLPQEHAARPG
ASPVAEGLGLPPKPTVPDLTAPVQAIALRPQAPAAQLAQACGARESIKREASLAPLATSP
PPGKWGTPKKGKEQPDRAHSQFLGIVGGSSGGGGGLPFYPGVRSAFKPAGLARAAAQSDP
YREEGGGKGPGLALGRLLGGGRAGGRPGSGESPAGHHHHHHHAHHHHHHHPKCLLAGEPP
PAGLPCPGALRAFPLLAGHPEEASAFKHVERAPPAAATTSLPSARYAALPAPGLPVERCA
LQPLDGGSLKAYPGGGGGGECSPLPAVMPAFTVYSGDLLYGPPAAYYPLKLHLGGLLKYP
ESISYLSGPAAAAAAAAAAAAAAAAIGPAELGSLASIDREIAMHTQQLSEMAAGKSRARL
DSGTLPPAVVAATGPGGGGGGGSAAGKPKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPL
KCKVCLRPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQSLMAK
AGDGPGPEPSYALEPGDPKSEDSDVDVCFTDDQSDPEAGGRGEHDS
Download sequence
Identical sequences ENSMUSP00000075562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]