SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000075960 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000075960
Domain Number 1 Region: 486-543
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-24
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 2 Region: 262-319
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 3 Region: 542-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 430-487
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-22
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 48-107
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.28e-22
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 6 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-20
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 374-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.71e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 225-276
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-16
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000075960
Domain Number - Region: 159-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000184
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000075960   Gene: ENSMUSG00000057409   Transcript: ENSMUST00000076664
Sequence length 652
Comment pep:known chromosome:GRCm38:17:21491256:21509764:1 gene:ENSMUSG00000057409 transcript:ENSMUST00000076664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQNKETWKMERQEAVAKDPGPQASYSLFFKEKIKEETQKEMAGSPLIMSQRLLTFGDVA
VEFPQEEWECLDSAQRALYIDVMLENYSNLVSVENYCISDTVHQHVKTEKESCQGNELGE
MLHEPTNCALYIRRDTIETSNNYRCSKDRDGSVDLLNQDRHKSTHTGEELCKSEDCEKSL
SLSSNLTENQRLYAANKLQSQGEYDDDFSSVYSLMQQTIYIGDTPHQCEKCRKCFSTASS
LTVHKRIHTGKKPYKCSVCGKSFTQCTNLKTHQRLHTGEKPYKCKECGKSFPQLSALKSH
QKIHTGERPYKCKECDKSFAHCSSFRRHQKTHRAEEHCSCPECGKVLHQLSHLRSHYRLH
TGEKPYKCNECDRSFTYYASYRRHQKTHSLDKFYKCKECGKSFLELSHLKRHYRIHTGEK
PYKCEVCDKSFTVNSTLKTHLKIHTGEKPFKCRECDKSFTKCSHLRRHQSVHTGEKPYRC
KECDKSFTECSTLRAHQKIHTGEKPYKCRECDKSFIQRSNLIIHQRVHTGERPYICKECG
KSFTKCSTLQIHQKIHTGEKPYKCMECNKSFTQDSHLRTHQRVHTGERPYICKECGKSFT
RCSYLRAHQKIHTGEKPYKCKDCDISFIQISNLRRHQRVHTGEKNTIATIVT
Download sequence
Identical sequences Q9Z117
ENSMUSP00000075960 ENSMUSP00000075960 10090.ENSMUSP00000075960 ENSMUSP00000075960 NP_038871.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]