SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078051 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078051
Domain Number 1 Region: 55-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.72e-25
Family KRAB domain (Kruppel-associated box) 0.00058
Further Details:      
 
Domain Number 2 Region: 316-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-22
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 3 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.86e-21
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 4 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.07e-21
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 529-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.66e-19
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.48e-18
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-17
Family Classic zinc finger, C2H2 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078051   Gene: ENSMUSG00000057551   Transcript: ENSMUST00000079042
Sequence length 607
Comment pep:known chromosome:GRCm38:9:19641224:19648048:1 gene:ENSMUSG00000057551 transcript:ENSMUST00000079042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATISLSPKFAMSSLDSADNQESEFSLPSKYDSCQQSLGLFACHAPEPDTPARVCSQESV
TFQDIAVDFTEKEWPLLDSSQRKLYKDVMLENYSNLSSLGYQVGKPRLISHLEQEEDLRM
EERGIQQGPSPDWGTTSKVKWSILLEDIFGKEASDDVRLETSHLLETSSEFSHLCEVFDI
GPHLAQPVGRPTGKRPYHHHSCGVKNRIHLTQHMSMNDGRKWHKCHQCQKAFTTSASLTR
HHRIHTGEKPYECSSCGKAFNDPSALRSHTRTHLKEKPFDCSQCSNAFRTLSALKIHMRV
HTGERPYKCDECGKAYGRSCHLIAHKRTHTGERPYECQDCGKAFQHPSHLKEHVRNHTGE
KPYECTQCGKAFRWKSNFNLHKKNHMVEKTYECKECGKSFSDLLSRRKHMRIHIVKKPVE
CHQCGKTFRNQSILKTHMNSHTGERPYGCDLCGKAFSASSNLTAHRKIHTQERHYECTSC
GKVFGDYLSRRRHMSIHLVKKRVDCRQCGKAFRNQSTLKTHMRSHTGEKPYECDHCGKAF
SIGSNLNVHRRIHTGEKPYECLICGKAFSDHSSLRSHVKTHRGRSSLRRLCGKGFSEYSN
AEEAWQT
Download sequence
Identical sequences Q8C0Q5
NP_766506.4.92730 XP_006510337.1.92730 XP_006510340.1.92730 XP_006510343.1.92730 XP_006510345.1.92730 XP_006510346.1.92730 XP_006510347.1.92730 XP_006510348.1.92730 XP_011240816.1.92730 XP_011240817.1.92730 XP_011240819.1.92730 XP_017168854.1.92730 XP_017168855.1.92730 10090.ENSMUSP00000078051 ENSMUSP00000078051 ENSMUSP00000078051 ENSMUSP00000078051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]