SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000078741 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000078741
Domain Number 1 Region: 1821-2067
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.73e-52
Family Ankyrin repeat 0.0000000547
Further Details:      
 
Domain Number 2 Region: 937-1067
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000267
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 1136-1269
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000455
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 594-725
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000204
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 5 Region: 494-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000304
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 6 Region: 456-499
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000184
Family EGF-type module 0.0012
Further Details:      
 
Domain Number 7 Region: 757-799
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000321
Family EGF-type module 0.0042
Further Details:      
 
Domain Number 8 Region: 795-833
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000357
Family EGF-type module 0.0068
Further Details:      
 
Domain Number 9 Region: 532-575
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000419
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 10 Region: 873-915
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000502
Family EGF-type module 0.0049
Further Details:      
 
Domain Number 11 Region: 415-461
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000339
Family EGF-type module 0.0013
Further Details:      
 
Domain Number 12 Region: 260-307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000452
Family EGF-type module 0.018
Further Details:      
 
Domain Number 13 Region: 182-219
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000104
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 14 Region: 1376-1415
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000139
Family EGF-type module 0.01
Further Details:      
 
Domain Number 15 Region: 835-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000144
Family EGF-type module 0.0085
Further Details:      
 
Domain Number 16 Region: 66-103
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000237
Family EGF-type module 0.016
Further Details:      
 
Domain Number 17 Region: 286-419
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000267
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 18 Region: 145-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000311
Family EGF-type module 0.027
Further Details:      
 
Domain Number 19 Region: 716-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000572
Family EGF-type module 0.015
Further Details:      
 
Domain Number 20 Region: 222-264
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000709
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 21 Region: 1305-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000816
Family EGF-type module 0.014
Further Details:      
 
Domain Number 22 Region: 1064-1105
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000109
Family EGF-type module 0.015
Further Details:      
 
Domain Number 23 Region: 1424-1456
Classification Level Classification E-value
Superfamily Notch domain 0.00000017
Family Notch domain 0.0013
Further Details:      
 
Domain Number 24 Region: 108-144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000219
Family EGF-type module 0.012
Further Details:      
 
Domain Number 25 Region: 1503-1534
Classification Level Classification E-value
Superfamily Notch domain 0.000000314
Family Notch domain 0.0034
Further Details:      
 
Domain Number 26 Region: 1264-1307
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000042
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 27 Region: 28-65
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000265
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000078741
Domain Number - Region: 1465-1497
Classification Level Classification E-value
Superfamily Notch domain 0.000327
Family Notch domain 0.0061
Further Details:      
 
Domain Number - Region: 1117-1144
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00873
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 917-946
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0304
Family EGF-type module 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000078741   Gene: ENSMUSG00000027878   Transcript: ENSMUST00000079812
Sequence length 2473
Comment pep:known chromosome:GRCm38:3:98013538:98150367:1 gene:ENSMUSG00000027878 transcript:ENSMUST00000079812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALRPAALRALLWLWLCGAGPAHALQCRGGQEPCVNEGTCVTYHNGTGFCRCPEGFLGE
YCQHRDPCEKNRCQNGGTCVPQGMLGKATCRCAPGFTGEDCQYSTSHPCFVSRPCQNGGT
CHMLSRDTYECTCQVGFTGKQCQWTDACLSHPCENGSTCTSVASQFSCKCPAGLTGQKCE
ADINECDIPGRCQHGGTCLNLPGSYRCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGSTCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAYASCTPGSTCIDRVASF
SCLCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEVNECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGILCDENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGLNCEINFDDCASNPCMHGVCV
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCICPEGPHHPSCYSQ
VNECLSNPCIHGNCTGGLSGYKCLCDAGWVGVNCEVDKNECLSNPCQNGGTCNNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDVSGYTCHCMLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESFSCLCAPGWQGKRCTVDVDECISKPCMNNGVCHNTQGSYVCECP
PGFSGMDCEEDINDCLANPCQNGGSCVDHVNTFSCQCHPGFIGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCTCPAGFHGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHDINECSSNPCLNAGTCVDGLGTYRCICPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
EKARPHCLCPPGWDGAYCDVLNVSCKAAALQKGVPVEHLCQHSGICINAGNTHHCQCPLG
YTGSYCEEQLDECASNPCQHGATCNDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCIDLVNHFKCSCPPGTRGLLCEENIDECAGGPHCLNGGQCVDRIGGYTCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCVQLKNNYNCICRSAFTGRHCETFLDVCPQKPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCIHTDSGPRCFCLNPKDCESGCAS
NPCQHGGTCYPQRQPPHYSCRCPPSFGGSHCELYTAPTSTPPATCQSQYCADKARDGICD
EACNSHACQWDGGDCSLTMEDPWANCTSTLRCWEYINNQCDEQCNTAECLFDNFECQRNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCASDQPENLAEGTLIIVVLLPPEQLLQ
DSRSFLRALGTLLHTNLRIKQDSQGALMVYPYFGEKSAAMKKQKMTRRSLPEEQEQEQEV
IGSKIFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVFSELESPRNAQL
LYLLAVAVVIILFFILLGVIMAKRKRKHGFLWLPEGFTLRRDSSNHKRREPVGQDAVGLK
NLSVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEDDPIDRRPWTQQHLEAADI
RHTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDLSDEDEDAEDSSANII
TDLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVA
ADAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKS
ALHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDIT
DHMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVLCGPNRSFLSLKHTPM
GKKARRPNTKSTMPTSLPNLAKEAKDAKGSRRKKCLNEKVQLSESSVTLSPVDSLESPHT
YVSDATSSPMITSPGILQASPTPLLAAAAPAAPVHTQHALSFSNLHDMQPLAPGASTVLP
SVSQLLSHHHIAPPGSSSAGSLGRLHPVPVPADWMNRVEMNETQYSEMFGMVLAPAEGAH
PGIAAPQSRPPEGKHMSTQREPLPPIVTFQLIPKGSIAQAAGAPQTQSSCPPAVAGPLPS
MYQIPEMPRLPSVAFPPTMMPQQEGQVAQTIVPTYHPFPASVGKYPTPPSQHSYASSNAA
ERTPSHGGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGGGGGQRGPGTH
MSEPPHSNMQVYA
Download sequence
Identical sequences G5E8J0
NP_035058.2.92730 ENSMUSP00000078741 ENSMUSP00000078741 ENSMUSP00000078741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]