SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079222 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079222
Domain Number 1 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.51e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 2 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.24e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-24
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 4 Region: 486-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.5e-23
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 5 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 643-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 48-101
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-17
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 8 Region: 333-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000866
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000079222
Domain Number - Region: 279-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000976
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079222   Gene: ENSMUSG00000034071   Transcript: ENSMUST00000080348
Sequence length 696
Comment pep:known chromosome:GRCm38:7:12415153:12422751:-1 gene:ENSMUSG00000034071 transcript:ENSMUST00000080348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRARPREETSATWSLLPLQNPMAVAMHRNIAQVPLTSEPVMELGLDVSFEDVAIHFSQE
EWVLLDKAQRLLYCSVMLENLALVASLGSCTGMGDEDVTCEPAEEVVCNTSPSPQETHLL
EIPVPALEEAWHQNEFLSTQPVQTLDLSRTGSGLKEDSNRHWKSYSGEKSCERDSHRATA
MSSCRSHGLTEPFIRGKDGEEALSSIAGVQQQGACHSEQPSTGCLQQQATCIREQPYSSA
KCGQALLNGEKHCKDGECQKGSSCKHTLVQCPSASSEKRPSECSKYEKAFSCSYKHAQHQ
DSHSGKRTHEHSQHEKPFSKKCRLNTQDRICPQERPYKCTECGKAFIYKSELVYHQRHHS
ARVHYECVECRKSFTYKSNLTEHQRIHTGERPYQCEQCGKSFRQNSSLFRHHRIHTGERP
YECSECGKSFRQIFNLIRHRRVHTGEMPHQCADCGKAFSCKAELSQHERIHSGEKPYECS
ECGKYFRQFSNLIRHRRVHTGDRPYKCSECEKSFSRKFILVQHQRVHTGERPYKCGECGT
SFTRKSDLIQHQRIHTGTRPYECEECGKSFRQCSSLIQHRRVHTGEKPYECIECGKAFSQ
SASLIQHQRLHTGERPYECSECGKSFSQSASLIQHQRSHSGEKPFECSDCSKPFTHKSDL
IQHRRVHTGERPYECHDCEKSFSRRSNLVRHQRVHT
Download sequence
Identical sequences B2RUI1
ENSMUSP00000079222 NP_001028992.2.92730 10090.ENSMUSP00000079222 ENSMUSP00000079222 ENSMUSP00000079222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]