SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079294 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079294
Domain Number 1 Region: 179-302
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.07e-60
Family Dystroglycan, domain 2 0.000000253
Further Details:      
 
Domain Number 2 Region: 495-596
Classification Level Classification E-value
Superfamily Cadherin-like 6.75e-19
Family Dystroglycan, N-terminal domain 0.014
Further Details:      
 
Domain Number 3 Region: 60-158
Classification Level Classification E-value
Superfamily Cadherin-like 2.82e-17
Family Dystroglycan, N-terminal domain 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079294   Gene: ENSMUSG00000039952   Transcript: ENSMUST00000080435
Sequence length 893
Comment pep:known chromosome:GRCm38:9:108205958:108263924:-1 gene:ENSMUSG00000039952 transcript:ENSMUST00000080435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVDNWLLHPLWGQTFLLLLSVAVAQAHWPSEPSEAVRDWKNQLEASMHSVLSDFQEAVP
TVVGIPDGTAVVGRSFRVSIPTDLIASSGEIIKVSAAGKEALPSWLHWDPHSHILEGLPL
DTDKGVHYISVSAARLGANGSHVPQTSSVFSIEVYPEDHNEPQSVRAASSDPGEVVPSAC
AADEPVTVLTVILDADLTKMTPKQRIDLLNRMQSFSEVELHNMKLVPVVNNRLFDMSAFM
AGPGNAKKVVENGALLSWKLGCSLNQNSVPDIRGVETPAREGAMSAQLGYPVVGWHIANK
KPTLPKRLRRQIHATPTPVTAIGPPTTAIQEPPSRIVPTPTSPAIAPPTETMAPPVRDPV
PGKPTVTIRTRGAIIQTPTLGPIQPTRVSEAGTTVPGQIRPTLTIPGYVEPTAVITPPTT
TTKKPRVSTPKPATPSTDSSTTTTRRPTKKPRTPRPVPRVTTKAPITRLETASPPTRIRT
TTSGVPRGGEPNQRPELKNHIDRVDAWVGTYFEVKIPSDTFYDNEDTTTDKLKLTLKLRE
QQLVGEKSWVQFNSNSQLMYGLPDSSHVGKHEYFMHATDKGGLSAVDAFEIHVHKRPQGD
KAPARFKARLAGDPAPVVNDIHKKIALVKKLAFAFGDRNCSSITLQNITRGSIVVEWTNN
TLPLEPCPKEQIIGLSRRIADENGKPRPAFSNALEPDFKALSIAVTGSGSCRHLQFIPVA
PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAMICYRKKRKGK
LTLEDQATFIKKGVPIIFADELDDSKPPPSSSMPLILQEEKAPLPPPEYPNQSMPETTPL
NQDTVGEYTPLRDEDPNAPPYQPPPPFTAPMEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences Q544G5 Q62165
ENSMUSP00000079294 ENSMUSP00000079294 NP_001263410.1.92730 NP_001263411.1.92730 NP_001263414.1.92730 NP_001263415.1.92730 NP_001263421.1.92730 NP_001263422.1.92730 NP_034147.1.92730 XP_006511699.1.92730 10090.ENSMUSP00000079294 NYSGRC-IgSF-Q62165 ENSMUSP00000079294 ENSMUSP00000128531 ENSMUSP00000130626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]