SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000079812 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000079812
Domain Number 1 Region: 582-639
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.65e-25
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 2 Region: 98-158
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 3 Region: 526-583
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 4 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.64e-22
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 5 Region: 638-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.46e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 694-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.88e-21
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 413-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 375-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 736-788
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000895
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000079812   Gene: ENSMUSG00000062861   Transcript: ENSMUST00000081022
Sequence length 825
Comment pep:known chromosome:GRCm38:7:6383318:6396633:1 gene:ENSMUSG00000062861 transcript:ENSMUST00000081022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQGMASVVSCEPWALLGRGALCTKARPGGGPAAGTVVAPGSPDRGRPRSRNSLASQDQQG
AVTSGTAHKALFSRDTNFLQEINRKQEAAPTGTRHKAKSQGLVTFGDVAVVFSQEEWEWL
NSEQRSLYWKVMLDNYRNLASLGLCASQPDMITSLEQGRDPWMMKRKMRKGQHLDLKAMQ
ETKEFPPKDLSEETLFLAVLRKQLLPHRPKCSMVRAAWEGGAVFTTHRGLKTNSGLARDS
PAQLVSAQRSFCKSVTWENCGDRGSVGQQSVQEAQDLLPRQDSHAERVTGRTWSTKLECS
TFRDQDSECTFERNEQETVTPNRAFSEGRDGMCIESGRWFHLNSSDERSHNCDSGKSFSS
NPVVVKETGICSGKKLFQCNECKKTFTQSSSLTVHQRIHTGEKPYKCNQCGKAFSDGSSF
ARHQRCHTGKKPYECPECGKAFIQNTSLVRHWRYYHTGEKPFDCIDCGKAFSDHIGLNQH
RRIHTGEKPYTCEVCHKSFRYGSSLTVHQRIHTGEKPYECEICRKAFSHHASLTQHQRVH
SGEKPFKCKECGKAFRQNIHLASHWRIHTGEKPFECGECGKSFSISSQLATHQRIHTGEK
PYECKVCRKAFTQKAHLAQHQKTHTGEKPYECKECGKAFSQTTHLIQHQRVHTGEKPYKC
LECGKAFGDNSSCTQHRRLHTGQRPYECVECGKTFKTKSSLICHRRCHTGEKPYECSACG
KAFSHRQSLSVHQRIHSGKKPYECKECRKTFIQIGHLNQHKRVHTGERTYNYKKGRRAFR
QTAHFAHHQQIHSGKSPAHHSLPSTSNPVDLFSKFVWNPSSLPSS
Download sequence
Identical sequences P10078
NP_780456.2.92730 ENSMUSP00000079812 10090.ENSMUSP00000079812 ENSMUSP00000079812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]