SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081221 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081221
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily RUN domain-like 4.45e-32
Family RUN domain 0.0015
Further Details:      
 
Domain Number 2 Region: 782-886
Classification Level Classification E-value
Superfamily PH domain-like 7.35e-20
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081221   Gene: ENSMUSG00000028917   Transcript: ENSMUST00000084203
Sequence length 1033
Comment pep:novel chromosome:GRCm38:4:141625734:141664118:-1 gene:ENSMUSG00000028917 transcript:ENSMUST00000084203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPREVKDRILENISLSVKKLQSYFAACEDETPAIRNHDKVLQRLCEHLDHALLYGLQDL
SSGYWVLVVHFTRREAIRQIEVLQHVATNLGRSRAWLYLALNENSLESYLRLFQENLGLL
QKYYVRNALVCSHDHLTLFLTLVSGLEFIRFDLDLDAPYLDLAPYMPDYYKPQYLLDFED
RLPSSVHGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVFPAVPSVPSTDWEDGD
LTDTISGPRSTASDLTSSKTSTKSPTQRHNPFNEEQAETASSDTTPVHTTSQEKEEAQAP
DQPDACTELEVIRVTKKKKIGKKKKTKLDEDASPLHPTSSQQKCGQQGEGDGLVGTPGLA
RDPSDTVLASPQEQGEGLSSTAGSSELSELSQMGLLIPEMKDTSMECLGQPLSKVIDKLH
GQLDPSTWCSHADPPEQSFRAGSPGEAPEKPPFCDFSEGLPAPMDFYRFTVESPSTVAPG
GGHHDPPGPSQPLHVPGSPAAALQEEEEGGGRGEGQTSQPLEDRQGEEIQEPEPQEPDSQ
LPLVSQEPVPEPVSQPEPGTHEALCKLKRDQPSPCLSSAEDSGVEEGQGSPSEMTHPSEF
RVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGNLQLLYVLLTDCYVYLLRKGATEKP
YLVEEAVSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVALAELFLASLKSAMIKGC
REPPYPSILTDATMEKLALAKFVAQESKCEASAVTVHFYGLVHWEDPMEEALGPVPCQCS
PAEGTITKEGMLHYKASTSYLGKEHWKACFVVLSNGILYQYPDRTDVIPLLSVNMGGEQC
GGCRRSNTTDRPHAFQVILADRPCLELSADSEAEMADWMQHLCQAVSKGVIPQGIAPSPC
IPCCLVITEDRLFTCHEDCQTSFFRSLGTARLADITAISTELGKEYCVLEFSQDSPQLLQ
PWVIYLSCTSELDRFLTALSSGWKAIYQVDLPHKAIHEASIKQKFEDALSLIHSAWQRSD
SLCRGRASRDPWC
Download sequence
Identical sequences Z4YJW6
10090.ENSMUSP00000081221 NP_001028322.1.92730 ENSMUSP00000081221 ENSMUSP00000081221 ENSMUSP00000081221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]