SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000081764 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000081764
Domain Number 1 Region: 10-172
Classification Level Classification E-value
Superfamily RUN domain-like 5.36e-39
Family RUN domain 0.00079
Further Details:      
 
Domain Number 2 Region: 1321-1435
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 3.01e-29
Family Supernatant protein factor (SPF), C-terminal domain 0.0011
Further Details:      
 
Domain Number 3 Region: 1132-1189
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000624
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMUSP00000081764
Domain Number - Region: 728-783
Classification Level Classification E-value
Superfamily Tropomyosin 0.0085
Family Tropomyosin 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000081764   Gene: ENSMUSG00000025241   Transcript: ENSMUST00000084715
Sequence length 1437
Comment pep:known chromosome:GRCm38:9:123789886:123851566:-1 gene:ENSMUSG00000025241 transcript:ENSMUST00000084715 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSSTETQLQRIIRDLQDAATELSHEFKEGGEPITDDSTSLHKFSYKLEYLLQFDQKEK
ASLLGSKKDYWDYFCACLAKVKGANDGIRFVRSISELRTSLGKGRAFIRYSLVHQRLADT
LQQCFMNTKVTSDWYYARSPFLKPKLSSDIVGQLYELTEVQFDLAPRGYDLDAAWPTFAR
RTLATSTSAYMWKPPSRSSSMSSLVSNYLQTQEMASSLDLNCSLNNEALESFDEMRLELD
QLEVREKQLQERVQQLDRENQALRMLVSRQGGQLQVEKEMGYLAVEDSIGLVSLVAELQK
QGDVSQATVKKLQSCLQALELNVDKKEYSPSALQLENMAKELDTVRGSLGRENQLLASLS
ERLARAEKGEKTPPDTELHQEPVPADLVLKFQELKGKLQALEGENTEAQELNRQQSIKLE
QLAKELQLKEEARASLAHLVKDVVPLQEELSGKKQESAQLRRQLQESLAHLSSVEEELAE
ARQQEKQHREEKQLLEQEATSLTWQLQLLETQLGQVSQLVSDLEEQKKQLMQERDHLSQR
VGTLEQLAEVHGPPQSAEMPEKRQQCLREEQVNNSTVSEAEQEELQKELQNMVDRNQLLE
GKLQALQTDYKALQQREAAIQGSLASLEAEQASIRHLGNQMEASLLAVKKAKETMKAQVA
EKEAALQSKESECQRLQEEADQCRLQAEAQAQELRALENQCQQQIQLIEVLSAEKGQQGL
SLPQVNTDQLALSQAQLEIHQGEAQRLQNEVVDLQAKLQVALGDRDKLQSQLGVAETVLR
EHKTLVQQLKEQNEALNRAHVQELLQCSEREGILQEESIYKAQKQEQELRALQAELSQVR
CSSEGAHLEHAELQDQLHRANTDTAELGIQVCALTAEKDRMEEALASLAQELQDSKEAAL
QERKGLELQVMQLQQEKEKLQEKVKAAEEAASSFSGLQAQLAQAEQLAQSLQETAHQEQD
ALKFQLSAEIMDHQNRLKTANEECGHLRAQLEEQGQQLQMTKEAVQELEITKAAMEEKLN
CTSSHLAECQATLLRKDEESTMLQTSLERTQKELEKATSKIQEYYNKLCQEVTNRERNDQ
KMLADLDDLNRTKKYLEERLIELLRDKDALWQKSDALEFQQKLSAEEKCLGDMEVNHCHD
CKREFSWIVRRHHCRICGRIFCYYCCNNYVVTKPSGKKERCCRACFQKFGEGSGSNDSSG
SGTSQGEPSPMVSPAEASPQSIGSQGINSVCRPPDDAVFDIITDEELCQIQESGSSLPET
PTETDSMDPNTAEQDTTSNSLTPEDTEDVPMGQDAEICLLKSGELMIKLPLTVEEVASFG
EGSRELFVRSSTYSLITITVAEPGLTISWVFSSDPKSISFSVVFQETEDTPLDQCKVLIP
TTRCNSHKENIRGQLKVRIPGIYLLIFDNTFSRFISKKVLYHLTVDRPVIYDGSDFP
Download sequence
Identical sequences Q8VDC1
ENSMUSP00000081764 ENSMUSP00000133222 ENSMUSP00000081764 NP_001103723.2.92730 NP_683727.3.92730 XP_017168648.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]