SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000083187 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000083187
Domain Number 1 Region: 131-456
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.31e-59
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000158
Further Details:      
 
Domain Number 2 Region: 462-595
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.81e-22
Family Ricin B-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000083187   Gene: ENSMUSG00000034040   Transcript: ENSMUST00000086023
Sequence length 598
Comment pep:known chromosome:GRCm38:5:130872082:131307918:-1 gene:ENSMUSG00000034040 transcript:ENSMUST00000086023 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASLRRVKVLLVLNLIAVAGFVIFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPSEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKELPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKAATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERKALRKSLKCKNFQWYLDHVYPEMRRYNNTIAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWAIKNPIK
Download sequence
Identical sequences Q59J92 Q7TT15
ENSMUSP00000083187 ENSMUSP00000083187 NP_660253.2.92730 XP_021078201.1.100879 10090.ENSMUSP00000083187 ENSMUSP00000083187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]