SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000086312 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000086312
Domain Number 1 Region: 3-118
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 5.49e-40
Family Rap30/74 interaction domains 0.000000504
Further Details:      
 
Domain Number 2 Region: 175-242
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.17e-23
Family DNA-binding domain from rap30 0.0000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000086312   Gene: ENSMUSG00000067995   Transcript: ENSMUST00000088922
Sequence length 249
Comment pep:known chromosome:GRCm38:14:75896937:76010865:-1 gene:ENSMUSG00000067995 transcript:ENSMUST00000088922 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKNQGRTEVSFTLNE
DLANIHDIGGKPASVSAPREHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAECRPAA
SENYMKLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYERKKKEDGKRARADK
QHVLDMLFSAFEKHQYYNLKDLVDITKQPVGYLKEILKEIGIQNVKGIHKNTWELKPEYR
HYQTEEKSD
Download sequence
Identical sequences Q3UMJ4 Q8R0A0
10090.ENSMUSP00000086312 ENSMUSP00000086312 ENSMUSP00000086312 NP_081092.1.92730 XP_021059151.1.100879 ENSMUSP00000086312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]