SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000087950 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000087950
Domain Number 1 Region: 7-162
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.7e-58
Family Dual specificity phosphatase-like 0.00000152
Further Details:      
 
Domain Number 2 Region: 125-331
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.23e-45
Family Dual specificity phosphatase-like 0.000000309
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000087950   Gene: ENSMUSG00000033502   Transcript: ENSMUST00000090464
Sequence length 603
Comment pep:known chromosome:GRCm38:3:116272553:116424032:-1 gene:ENSMUSG00000033502 transcript:ENSMUST00000090464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESGELIGACEFMKDRLYFATLRNRPKSTINIHYFSIDEELVYENFYADFGPLNLAMV
YRYCCKLNKKLKSYSLSRKKIVHYTSFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLS
GSNPPYLPFRDASFGNCTYNLTVLDCLQGIRKGLQHGFFDFETFDAEEYEHYERVENGDF
NWIVPGKFLAFSGPHPKSKIENGYPLHAPEAYFPYFKKNNVTTIVRLNKKIYEAKRFTDA
GFEHYDLFFIDGSTPSDNIVRRFLNICENTEGAIAVHCKAGLGRTGTLIACYVMKHYRFT
HAEIIAWIRICRPGSIIGPQQHFLKEKQASLWVQGDIFRSKLKNRPSSEGSITKIISTLD
DMSIGANLSKLQSTERIGENNFEDEDMEIKNNVTQGDKLRALKSQRHPRSSPSCAFRSDD
MKGHQRAMAQTFRLSSSPQPTMSTMKTSKVCLSPSVTAKKISRGSLSSGANIRSFSINSR
LASSLGNLNAGTEEPETKKTTSLTKAAFIASPFTSFLNGSTQTPGRNYPELNNNQYTRSS
NSNSSSSSSGLGGNLNSSPVPQSAKPEEHTTILRPSFPGSLSSSSVRFLSRSIPSLQSEY
VHY
Download sequence
Identical sequences Q6GQT0
ENSMUSP00000087950 ENSMUSP00000087950 10090.ENSMUSP00000087950 NYSGXRC-8650b NP_001074287.1.92730 ENSMUSP00000087950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]