SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088031 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088031
Domain Number 1 Region: 337-574
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.74e-69
Family Nuclear receptor ligand-binding domain 0.0000122
Further Details:      
 
Domain Number 2 Region: 100-190
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.34e-29
Family Nuclear receptor 0.0000147
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088031   Gene: ENSMUSG00000021775   Transcript: ENSMUST00000090543
Sequence length 576
Comment pep:known chromosome:GRCm38:14:18204054:18239127:-1 gene:ENSMUSG00000021775 transcript:ENSMUST00000090543 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELNAGGVIAYISSSSSASSPASCHSEGSENSFQSSSSSVPSSPNSSNCDANGNPKNADI
SSIDGVLKSDRTDCPVKTGKTSAPGMTKSHSGMTKFSGMVLLCKVCGDVASGFHYGVHAC
EGCKGFFRRSIQQNIQYKKCLKNENCSIMRMNRNRCQQCRFKKCLSVGMSRDAVRFGRIP
KREKQRMLIEMQSAMKTMMNTQFSGHLQNDTLAEQHDQSALPAQEQLRPKSQLEQENIKN
TPSDFAKEEVIGMVTRAHKDTFLYNQEHRENSSESMPPQRGERIPRNMEQYNLNQDHRGS
GIHNHFPCSERQQHLSGQYKGRNIMHYPNGHAVCIANGHCMNFSSAYTQRVCDRIPVGGC
SQTENRNSYLCNTGGRMHLVCPMSKSPYVDPQKSGHEIWEEFSMSFTPAVKEVVEFAKRI
PGFRDLSQHDQVNLLKAGTFEVLMVRFASLFDAKERTVTFLSGKKYSVDDLHSMGAGDLL
SSMFEFSEKLNALQLSDEEMSLFTAVVLVSADRSGIENVNSVEALQETLIRALRTLIMKN
HPNEASIFTKLLLKLPDLRSLNNMHSEELLAFKVHP
Download sequence
Identical sequences Q4VAB7 Q60674
ENSMUSP00000088031 NP_035714.3.92730 ENSMUSP00000088031 ENSMUSP00000088031 10090.ENSMUSP00000088031

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]