SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMUSP00000088774 from Mus musculus 76_38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMUSP00000088774
Domain Number 1 Region: 855-913
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000654
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 2 Region: 48-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000981
Family TSP-1 type 1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 625-691
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 746-800
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000275
Family TSP-1 type 1 repeat 0.0078
Further Details:      
 
Domain Number 5 Region: 800-860
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 6 Region: 568-628
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 693-743
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000589
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMUSP00000088774   Gene: ENSMUSG00000036040   Transcript: ENSMUST00000091233
Sequence length 957
Comment pep:known chromosome:GRCm38:2:27079379:27108981:1 gene:ENSMUSG00000036040 transcript:ENSMUST00000091233 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGRRQHPHWAWSLLAVAVVAGGAAPTEASDNSPTSNSLEGGADTTAYWWGEWTKWTACS
RSCGGGVTSQERHCLQQRRKSVPGTGNRTCVGTSKRYQLCRVQECPPDGRSFREEQCVSF
NSRVYDGRAYQWKPLYPDDYVHISSKPCDLHCSTVDGQRQLTVPARDGTSCKLTDLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNNHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGFYFFNGNYKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMVWNQNGKSPSITFEYTLLQSPHMHHLPPVYYSFSEAASQSTESTERQ
ELDSARLLGFMQHNGSLYRQTSSERLGLNSQLFQPPAPEVELGPSRGQESNEVCKQASGG
VCEGPPRGKGFQDHNATGRAFSADKDDREISAHFTSHELLSANTISDQLLGTGSESEEFS
LNETMNSIFAQGAPRSSPAESLYVDYEENEGPAAYLINGSYLELSSDRINTSSEAPFPNT
SASPPNLAGNRTHKARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVRY
DGVEVDDSYCDALTRPEPVHEFCAGRECQPRWETSSWSECSRTCGEGHQFRIVRCWKMLS
PGFDSSVYSDLCEATEAVRPEERKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCS
EDEKLCDPSTKPVGEKNCTGPPCDRQWTVSDWGPCSGSCGQGRTIRHVYCKTSDGRVVPE
SQCQTETKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGKPQIRSG
PECGLARKPPEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLV
KPVGRQACDLQPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSKACCRSCRPPHS
Download sequence
Identical sequences A1A5B7 Q7TSK7
ENSMUSP00000088774 NP_084257.1.92730 ENSMUSP00000088774 10090.ENSMUSP00000088774 ENSMUSP00000088774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]